Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 200863..201599 | Replicon | plasmid pKP167-261 |
Accession | NZ_CP098759 | ||
Organism | Klebsiella pneumoniae strain KP167 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
Locus tag | ND678_RS26855 | Protein ID | WP_004187044.1 |
Coordinates | 201117..201599 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | ND678_RS26850 | Protein ID | WP_003026799.1 |
Coordinates | 200863..201129 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND678_RS26835 (ND678_26825) | 196335..197729 | + | 1395 | WP_032439652.1 | cytosine permease | - |
ND678_RS26840 (ND678_26830) | 197741..198949 | + | 1209 | WP_032448288.1 | imidazolonepropionase | - |
ND678_RS26845 (ND678_26835) | 198942..199751 | + | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
ND678_RS26850 (ND678_26840) | 200863..201129 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
ND678_RS26855 (ND678_26845) | 201117..201599 | + | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
ND678_RS26860 (ND678_26850) | 201810..203156 | + | 1347 | WP_077251107.1 | ISNCY family transposase | - |
ND678_RS26865 (ND678_26855) | 203316..204020 | + | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
ND678_RS26870 (ND678_26860) | 204297..205643 | + | 1347 | WP_077254728.1 | ISNCY family transposase | - |
ND678_RS26875 (ND678_26865) | 205692..206090 | + | 399 | WP_032422684.1 | helix-turn-helix domain-containing protein | - |
ND678_RS26880 (ND678_26870) | 206238..206348 | - | 111 | Protein_218 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | iutA / iucD / iucC / iucB / iucA | 1..261525 | 261525 | |
- | inside | Integron | dfrA14 / ant(3'')-Ia / cmlA1 / ARR-2 / blaOXA-10 | iutA / iucD / iucC / iucB / iucA | 53..261411 | 261358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T248020 WP_004187044.1 NZ_CP098759:201117-201599 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|