Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 155955..156598 Replicon plasmid pKP167-261
Accession NZ_CP098759
Organism Klebsiella pneumoniae strain KP167

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag ND678_RS26635 Protein ID WP_016236302.1
Coordinates 156182..156598 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag ND678_RS26630 Protein ID WP_001261282.1
Coordinates 155955..156185 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND678_RS26600 (ND678_26590) 150964..152139 + 1176 Protein_162 IS3 family transposase -
ND678_RS26605 (ND678_26595) 152521..153306 - 786 WP_050485696.1 site-specific integrase -
ND678_RS26610 (ND678_26600) 153352..153873 - 522 WP_032448294.1 hypothetical protein -
ND678_RS26615 (ND678_26605) 153931..154323 - 393 WP_074422814.1 hypothetical protein -
ND678_RS26620 (ND678_26610) 154432..155376 - 945 WP_032448293.1 hypothetical protein -
ND678_RS26625 (ND678_26615) 155576..155998 - 423 WP_050485703.1 hypothetical protein -
ND678_RS26630 (ND678_26620) 155955..156185 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ND678_RS26635 (ND678_26625) 156182..156598 + 417 WP_016236302.1 type II toxin-antitoxin system VapC family toxin Toxin
ND678_RS26640 (ND678_26630) 156672..158234 + 1563 WP_004206609.1 AAA family ATPase -
ND678_RS26645 (ND678_26635) 158219..159241 + 1023 WP_032439672.1 helicase UvrD -
ND678_RS26650 (ND678_26640) 159786..160694 + 909 WP_137877090.1 HNH endonuclease -
ND678_RS26655 (ND678_26645) 160880..161230 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR iutA / iucD / iucC / iucB / iucA 1..261525 261525
- inside Integron dfrA14 / ant(3'')-Ia / cmlA1 / ARR-2 / blaOXA-10 iutA / iucD / iucC / iucB / iucA 53..261411 261358


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15091.55 Da        Isoelectric Point: 7.1084

>T248019 WP_016236302.1 NZ_CP098759:156182-156598 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT248019 WP_001261282.1 NZ_CP098759:155955-156185 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References