Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3104385..3105004 Replicon chromosome
Accession NZ_CP098758
Organism Klebsiella pneumoniae strain KP167

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag ND678_RS14940 Protein ID WP_002892050.1
Coordinates 3104385..3104603 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag ND678_RS14945 Protein ID WP_002892066.1
Coordinates 3104630..3105004 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND678_RS14905 (3100433) 3100433..3100696 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
ND678_RS14910 (3100696) 3100696..3100836 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
ND678_RS14915 (3100833) 3100833..3101531 - 699 WP_002892021.1 GNAT family protein -
ND678_RS14920 (3101632) 3101632..3103082 + 1451 Protein_2900 PLP-dependent aminotransferase family protein -
ND678_RS14925 (3103057) 3103057..3103527 - 471 WP_002892026.1 YlaC family protein -
ND678_RS14930 (3103548) 3103548..3103688 + 141 WP_004147370.1 hypothetical protein -
ND678_RS14935 (3103660) 3103660..3104226 - 567 WP_002892030.1 maltose O-acetyltransferase -
ND678_RS14940 (3104385) 3104385..3104603 - 219 WP_002892050.1 HHA domain-containing protein Toxin
ND678_RS14945 (3104630) 3104630..3105004 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
ND678_RS14950 (3105490) 3105490..3108636 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
ND678_RS14955 (3108659) 3108659..3109852 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T248013 WP_002892050.1 NZ_CP098758:c3104603-3104385 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT248013 WP_002892066.1 NZ_CP098758:c3105004-3104630 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References