Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2363231..2363747 | Replicon | chromosome |
Accession | NZ_CP098758 | ||
Organism | Klebsiella pneumoniae strain KP167 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | ND678_RS11340 | Protein ID | WP_009486548.1 |
Coordinates | 2363463..2363747 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | ND678_RS11335 | Protein ID | WP_002886901.1 |
Coordinates | 2363231..2363473 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND678_RS11320 (2359259) | 2359259..2359999 | + | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
ND678_RS11325 (2360066) | 2360066..2361220 | + | 1155 | WP_020316350.1 | lactonase family protein | - |
ND678_RS11330 (2361243) | 2361243..2363153 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
ND678_RS11335 (2363231) | 2363231..2363473 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ND678_RS11340 (2363463) | 2363463..2363747 | + | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ND678_RS11345 (2363751) | 2363751..2364215 | - | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
ND678_RS11350 (2364523) | 2364523..2366661 | - | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
ND678_RS11355 (2367018) | 2367018..2367761 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
ND678_RS11360 (2367764) | 2367764..2367937 | - | 174 | WP_002886906.1 | hypothetical protein | - |
ND678_RS11365 (2368067) | 2368067..2368330 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T248011 WP_009486548.1 NZ_CP098758:2363463-2363747 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |