Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 1483952..1484538 | Replicon | chromosome |
| Accession | NZ_CP098758 | ||
| Organism | Klebsiella pneumoniae strain KP167 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | ND678_RS07190 | Protein ID | WP_002920800.1 |
| Coordinates | 1483952..1484320 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | ND678_RS07195 | Protein ID | WP_004174006.1 |
| Coordinates | 1484317..1484538 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND678_RS07170 (1479455) | 1479455..1480525 | - | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| ND678_RS07175 (1480527) | 1480527..1481372 | - | 846 | WP_004174009.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| ND678_RS07180 (1481369) | 1481369..1482256 | - | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| ND678_RS07185 (1482363) | 1482363..1483679 | - | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| ND678_RS07190 (1483952) | 1483952..1484320 | - | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| ND678_RS07195 (1484317) | 1484317..1484538 | - | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| ND678_RS07200 (1484702) | 1484702..1485415 | - | 714 | WP_009484078.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| ND678_RS07205 (1485417) | 1485417..1486184 | - | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| ND678_RS07210 (1486181) | 1486181..1487458 | - | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| ND678_RS07215 (1487455) | 1487455..1488381 | - | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1475927..1487458 | 11531 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T248008 WP_002920800.1 NZ_CP098758:c1484320-1483952 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |