248008

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1483952..1484538 Replicon chromosome
Accession NZ_CP098758
Organism Klebsiella pneumoniae strain KP167

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag ND678_RS07190 Protein ID WP_002920800.1
Coordinates 1483952..1484320 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag ND678_RS07195 Protein ID WP_004174006.1
Coordinates 1484317..1484538 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND678_RS07170 (1479455) 1479455..1480525 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
ND678_RS07175 (1480527) 1480527..1481372 - 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
ND678_RS07180 (1481369) 1481369..1482256 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
ND678_RS07185 (1482363) 1482363..1483679 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
ND678_RS07190 (1483952) 1483952..1484320 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
ND678_RS07195 (1484317) 1484317..1484538 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ND678_RS07200 (1484702) 1484702..1485415 - 714 WP_009484078.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
ND678_RS07205 (1485417) 1485417..1486184 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
ND678_RS07210 (1486181) 1486181..1487458 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
ND678_RS07215 (1487455) 1487455..1488381 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1475927..1487458 11531


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T248008 WP_002920800.1 NZ_CP098758:c1484320-1483952 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT248008 WP_004174006.1 NZ_CP098758:c1484538-1484317 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References