Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 998853..999510 | Replicon | chromosome |
Accession | NZ_CP098758 | ||
Organism | Klebsiella pneumoniae strain KP167 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | ND678_RS04710 | Protein ID | WP_002916310.1 |
Coordinates | 998853..999263 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | ND678_RS04715 | Protein ID | WP_002916312.1 |
Coordinates | 999244..999510 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND678_RS04690 (994853) | 994853..996586 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
ND678_RS04695 (996592) | 996592..997305 | - | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
ND678_RS04700 (997328) | 997328..998224 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
ND678_RS04705 (998325) | 998325..998846 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
ND678_RS04710 (998853) | 998853..999263 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
ND678_RS04715 (999244) | 999244..999510 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
ND678_RS04720 (999756) | 999756..1000739 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
ND678_RS04725 (1000890) | 1000890..1001549 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
ND678_RS04730 (1001713) | 1001713..1002024 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
ND678_RS04735 (1002074) | 1002074..1002802 | + | 729 | WP_009485882.1 | MurR/RpiR family transcriptional regulator | - |
ND678_RS04740 (1002921) | 1002921..1004354 | + | 1434 | WP_009485881.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T248007 WP_002916310.1 NZ_CP098758:c999263-998853 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |