Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 5535011..5535654 | Replicon | chromosome |
| Accession | NZ_CP098757 | ||
| Organism | Klebsiella oxytoca strain AHC-6 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NDX50_RS25885 | Protein ID | WP_064396313.1 |
| Coordinates | 5535011..5535427 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A1V8NRE0 |
| Locus tag | NDX50_RS25890 | Protein ID | WP_064396317.1 |
| Coordinates | 5535424..5535654 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDX50_RS25865 (NDX50_25835) | 5530700..5531368 | - | 669 | WP_004103895.1 | GTP cyclohydrolase I FolE | - |
| NDX50_RS25870 (NDX50_25840) | 5531735..5532571 | + | 837 | WP_004103897.1 | S-formylglutathione hydrolase | - |
| NDX50_RS25875 (NDX50_25845) | 5532838..5534208 | + | 1371 | Protein_5066 | IS3 family transposase | - |
| NDX50_RS25880 (NDX50_25850) | 5534388..5534882 | - | 495 | WP_064396312.1 | N-acetyltransferase | - |
| NDX50_RS25885 (NDX50_25855) | 5535011..5535427 | - | 417 | WP_064396313.1 | PIN domain-containing protein | Toxin |
| NDX50_RS25890 (NDX50_25860) | 5535424..5535654 | - | 231 | WP_064396317.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NDX50_RS25895 (NDX50_25865) | 5536376..5538349 | - | 1974 | WP_004114107.1 | catecholate siderophore receptor CirA | - |
| NDX50_RS25900 (NDX50_25870) | 5538654..5540123 | - | 1470 | WP_004103903.1 | amino acid permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 5533603..5534208 | 605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14938.33 Da Isoelectric Point: 7.2449
>T248006 WP_064396313.1 NZ_CP098757:c5535427-5535011 [Klebsiella oxytoca]
VIKTYMLDTNICSFIMREQPEAVIKRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHGLLVEAFCARLDAILAWDRA
AVDATTEIKAALTAAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLILEDWAN
VIKTYMLDTNICSFIMREQPEAVIKRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHGLLVEAFCARLDAILAWDRA
AVDATTEIKAALTAAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLILEDWAN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|