Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3029098..3029717 | Replicon | chromosome |
Accession | NZ_CP098757 | ||
Organism | Klebsiella oxytoca strain AHC-6 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | NDX50_RS14305 | Protein ID | WP_004099646.1 |
Coordinates | 3029098..3029316 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NDX50_RS14310 | Protein ID | WP_004099648.1 |
Coordinates | 3029343..3029717 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDX50_RS14270 (NDX50_14260) | 3025135..3025398 | + | 264 | WP_064396976.1 | type B 50S ribosomal protein L31 | - |
NDX50_RS14275 (NDX50_14265) | 3025398..3025538 | + | 141 | WP_078774955.1 | type B 50S ribosomal protein L36 | - |
NDX50_RS14280 (NDX50_14270) | 3025535..3026233 | - | 699 | WP_004099639.1 | GNAT family protein | - |
NDX50_RS14285 (NDX50_14275) | 3026335..3027789 | + | 1455 | WP_224313875.1 | PLP-dependent aminotransferase family protein | - |
NDX50_RS14290 (NDX50_14280) | 3027764..3028234 | - | 471 | WP_004111038.1 | YlaC family protein | - |
NDX50_RS14295 (NDX50_14285) | 3028265..3028402 | + | 138 | WP_224226357.1 | hypothetical protein | - |
NDX50_RS14300 (NDX50_14290) | 3028371..3028937 | - | 567 | WP_023320460.1 | maltose O-acetyltransferase | - |
NDX50_RS14305 (NDX50_14295) | 3029098..3029316 | - | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
NDX50_RS14310 (NDX50_14300) | 3029343..3029717 | - | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
NDX50_RS14315 (NDX50_14305) | 3030199..3033345 | - | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NDX50_RS14320 (NDX50_14310) | 3033368..3034561 | - | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T248001 WP_004099646.1 NZ_CP098757:c3029316-3029098 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT248001 WP_004099648.1 NZ_CP098757:c3029717-3029343 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|