Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 2757567..2758386 | Replicon | chromosome |
Accession | NZ_CP098757 | ||
Organism | Klebsiella oxytoca strain AHC-6 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | NDX50_RS13010 | Protein ID | WP_004110819.1 |
Coordinates | 2757567..2757824 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | NDX50_RS13015 | Protein ID | WP_064398595.1 |
Coordinates | 2757835..2758386 (+) | Length | 184 a.a. |
Genomic Context
Location: 2757567..2757824 (258 bp)
Type: Toxin
Protein ID: WP_004110819.1
Type: Toxin
Protein ID: WP_004110819.1
Location: 2757835..2758386 (552 bp)
Type: Antitoxin
Protein ID: WP_064398595.1
Type: Antitoxin
Protein ID: WP_064398595.1
Location: 2758500..2758874 (375 bp)
Type: Others
Protein ID: Protein_2528
Type: Others
Protein ID: Protein_2528
Location: 2759268..2760032 (765 bp)
Type: Others
Protein ID: WP_224314054.1
Type: Others
Protein ID: WP_224314054.1
Location: 2753339..2754115 (777 bp)
Type: Others
Protein ID: WP_004099223.1
Type: Others
Protein ID: WP_004099223.1
Location: 2754251..2755726 (1476 bp)
Type: Others
Protein ID: WP_047720344.1
Type: Others
Protein ID: WP_047720344.1
Location: 2755801..2756985 (1185 bp)
Type: Others
Protein ID: WP_004099225.1
Type: Others
Protein ID: WP_004099225.1
Location: 2760078..2761241 (1164 bp)
Type: Others
Protein ID: WP_024273763.1
Type: Others
Protein ID: WP_024273763.1
Location: 2761259..2762536 (1278 bp)
Type: Others
Protein ID: WP_064398600.1
Type: Others
Protein ID: WP_064398600.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDX50_RS12995 (NDX50_12985) | 2753339..2754115 | - | 777 | WP_004099223.1 | Uxu operon transcriptional regulator | - |
NDX50_RS13000 (NDX50_12990) | 2754251..2755726 | - | 1476 | WP_047720344.1 | fructuronate reductase | - |
NDX50_RS13005 (NDX50_12995) | 2755801..2756985 | - | 1185 | WP_004099225.1 | mannonate dehydratase | - |
NDX50_RS13010 (NDX50_13000) | 2757567..2757824 | + | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
NDX50_RS13015 (NDX50_13005) | 2757835..2758386 | + | 552 | WP_064398595.1 | N-acetyltransferase | Antitoxin |
NDX50_RS13020 (NDX50_13010) | 2758500..2758874 | + | 375 | Protein_2528 | class I SAM-dependent methyltransferase | - |
NDX50_RS13025 (NDX50_13015) | 2759268..2760032 | + | 765 | WP_224314054.1 | class I SAM-dependent methyltransferase | - |
NDX50_RS13030 (NDX50_13020) | 2760078..2761241 | - | 1164 | WP_024273763.1 | MFS transporter | - |
NDX50_RS13035 (NDX50_13025) | 2761259..2762536 | - | 1278 | WP_064398600.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T247999 WP_004110819.1 NZ_CP098757:2757567-2757824 [Klebsiella oxytoca]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20094.97 Da Isoelectric Point: 7.0633
>AT247999 WP_064398595.1 NZ_CP098757:2757835-2758386 [Klebsiella oxytoca]
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGVSDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHAAYYPRHGFDPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGVSDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHAAYYPRHGFDPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H6Y2 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |