Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 2227867..2228588 | Replicon | chromosome |
| Accession | NZ_CP098757 | ||
| Organism | Klebsiella oxytoca strain AHC-6 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | NDX50_RS10665 | Protein ID | WP_087835501.1 |
| Coordinates | 2228271..2228588 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NDX50_RS10660 | Protein ID | WP_117031222.1 |
| Coordinates | 2227867..2228232 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDX50_RS10615 (NDX50_10605) | 2223163..2223867 | + | 705 | WP_265782342.1 | WYL domain-containing protein | - |
| NDX50_RS10620 (NDX50_10610) | 2223867..2224436 | + | 570 | WP_265782351.1 | hypothetical protein | - |
| NDX50_RS10625 (NDX50_10615) | 2224473..2224925 | + | 453 | WP_151887980.1 | hypothetical protein | - |
| NDX50_RS10630 (NDX50_10620) | 2224922..2225371 | + | 450 | WP_265782344.1 | IrmA family protein | - |
| NDX50_RS10635 (NDX50_10625) | 2225443..2225673 | + | 231 | WP_265782345.1 | DUF905 domain-containing protein | - |
| NDX50_RS10640 (NDX50_10630) | 2225773..2226594 | + | 822 | WP_265782346.1 | DUF932 domain-containing protein | - |
| NDX50_RS10645 (NDX50_10635) | 2226625..2227068 | + | 444 | WP_265782347.1 | antirestriction protein | - |
| NDX50_RS10650 (NDX50_10640) | 2227081..2227623 | + | 543 | WP_265782348.1 | DNA repair protein RadC | - |
| NDX50_RS10655 (NDX50_10645) | 2227620..2227841 | + | 222 | WP_265782349.1 | DUF987 family protein | - |
| NDX50_RS10660 (NDX50_10650) | 2227867..2228232 | + | 366 | WP_117031222.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NDX50_RS10665 (NDX50_10655) | 2228271..2228588 | + | 318 | WP_087835501.1 | TA system toxin CbtA family protein | Toxin |
| NDX50_RS10670 (NDX50_10660) | 2228892..2230394 | + | 1503 | WP_265782350.1 | reverse transcriptase domain-containing protein | - |
| NDX50_RS10675 (NDX50_10665) | 2231330..2231764 | - | 435 | WP_049094495.1 | VOC family protein | - |
| NDX50_RS10680 (NDX50_10670) | 2231911..2232234 | - | 324 | WP_064396491.1 | endoribonuclease SymE | - |
| NDX50_RS10685 (NDX50_10675) | 2232524..2233318 | - | 795 | WP_202406657.1 | DNA/RNA non-specific endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2198959..2232234 | 33275 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12152.96 Da Isoelectric Point: 6.2150
>T247998 WP_087835501.1 NZ_CP098757:2228271-2228588 [Klebsiella oxytoca]
MQILSSQPTQAAQPCLSPVEIWQRLLTHLLLKHYGLALNDTPFSNETVIQEHIDAGITMANAMNFLVEKYELVRIDRREF
DWQEKSPYLQAVDILRARQATGMRQ
MQILSSQPTQAAQPCLSPVEIWQRLLTHLLLKHYGLALNDTPFSNETVIQEHIDAGITMANAMNFLVEKYELVRIDRREF
DWQEKSPYLQAVDILRARQATGMRQ
Download Length: 318 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13423.95 Da Isoelectric Point: 4.7864
>AT247998 WP_117031222.1 NZ_CP098757:2227867-2228232 [Klebsiella oxytoca]
MNNHSESGTKPENPACQQWGLQSTITPCFGARLVQEGNRLHFLADRAGFNGAFSDDDALHLEQTFPLILKQLEMMLTSGE
LSPRHQHSVTLYHNGLSCEADTLGSCGYIYIAIYPDQTEPQ
MNNHSESGTKPENPACQQWGLQSTITPCFGARLVQEGNRLHFLADRAGFNGAFSDDDALHLEQTFPLILKQLEMMLTSGE
LSPRHQHSVTLYHNGLSCEADTLGSCGYIYIAIYPDQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|