Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 902994..903586 | Replicon | chromosome |
Accession | NZ_CP098757 | ||
Organism | Klebsiella oxytoca strain AHC-6 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | NDX50_RS04380 | Protein ID | WP_016808034.1 |
Coordinates | 902994..903368 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A2J4YM08 |
Locus tag | NDX50_RS04385 | Protein ID | WP_004105957.1 |
Coordinates | 903365..903586 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDX50_RS04360 (NDX50_04355) | 898343..899686 | - | 1344 | WP_004105949.1 | glycoside-pentoside-hexuronide (GPH):cation symporter | - |
NDX50_RS04365 (NDX50_04360) | 899794..900660 | + | 867 | WP_004105950.1 | AraC family transcriptional regulator | - |
NDX50_RS04370 (NDX50_04365) | 900789..902432 | + | 1644 | WP_004115710.1 | glycoside hydrolase family 43 protein | - |
NDX50_RS04375 (NDX50_04370) | 902511..903014 | + | 504 | WP_224313900.1 | M48 family metallopeptidase | - |
NDX50_RS04380 (NDX50_04375) | 902994..903368 | - | 375 | WP_016808034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NDX50_RS04385 (NDX50_04380) | 903365..903586 | - | 222 | WP_004105957.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NDX50_RS04390 (NDX50_04385) | 903746..904735 | + | 990 | WP_023321666.1 | Gfo/Idh/MocA family oxidoreductase | - |
NDX50_RS04395 (NDX50_04390) | 904986..905954 | + | 969 | WP_004115718.1 | TerC family protein | - |
NDX50_RS04400 (NDX50_04395) | 906209..907456 | + | 1248 | WP_064397182.1 | serine/threonine transporter SstT | - |
NDX50_RS04405 (NDX50_04400) | 907471..908025 | - | 555 | WP_004105965.1 | YgjV family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13835.89 Da Isoelectric Point: 6.0752
>T247997 WP_016808034.1 NZ_CP098757:c903368-902994 [Klebsiella oxytoca]
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHCEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHCEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|