Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 678792..679449 | Replicon | chromosome |
Accession | NZ_CP098757 | ||
Organism | Klebsiella oxytoca strain AHC-6 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A181X6I0 |
Locus tag | NDX50_RS03315 | Protein ID | WP_004105559.1 |
Coordinates | 678792..679202 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A285B945 |
Locus tag | NDX50_RS03320 | Protein ID | WP_004105561.1 |
Coordinates | 679183..679449 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDX50_RS03295 (NDX50_03290) | 674769..676502 | - | 1734 | WP_024274698.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NDX50_RS03300 (NDX50_03295) | 676508..677221 | - | 714 | WP_004105554.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NDX50_RS03305 (NDX50_03300) | 677244..678140 | - | 897 | WP_064397254.1 | site-specific tyrosine recombinase XerD | - |
NDX50_RS03310 (NDX50_03305) | 678262..678783 | + | 522 | WP_004105557.1 | flavodoxin FldB | - |
NDX50_RS03315 (NDX50_03310) | 678792..679202 | - | 411 | WP_004105559.1 | protein YgfX | Toxin |
NDX50_RS03320 (NDX50_03315) | 679183..679449 | - | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
NDX50_RS03325 (NDX50_03320) | 679693..680676 | + | 984 | WP_064397252.1 | tRNA-modifying protein YgfZ | - |
NDX50_RS03330 (NDX50_03325) | 680852..683650 | + | 2799 | WP_064397250.1 | transcriptional regulator DagR | - |
NDX50_RS03335 (NDX50_03330) | 683771..684196 | + | 426 | WP_004124962.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T247996 WP_004105559.1 NZ_CP098757:c679202-678792 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A181X6I0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285B945 |