Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 610111..610764 | Replicon | chromosome |
Accession | NZ_CP098755 | ||
Organism | Brevibacillus sp. BB3-R1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NDK47_RS03160 | Protein ID | WP_198828445.1 |
Coordinates | 610414..610764 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NDK47_RS03155 | Protein ID | WP_251873496.1 |
Coordinates | 610111..610410 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDK47_RS03130 (NDK47_03130) | 605235..605642 | + | 408 | WP_251875941.1 | holo-ACP synthase | - |
NDK47_RS03135 (NDK47_03135) | 605888..606922 | + | 1035 | WP_251873492.1 | DUF4367 domain-containing protein | - |
NDK47_RS03140 (NDK47_03140) | 607180..607548 | - | 369 | WP_251873493.1 | hypothetical protein | - |
NDK47_RS03145 (NDK47_03145) | 608297..608737 | + | 441 | WP_251873494.1 | hypothetical protein | - |
NDK47_RS03150 (NDK47_03150) | 608741..609943 | + | 1203 | WP_251873495.1 | alanine racemase | - |
NDK47_RS03155 (NDK47_03155) | 610111..610410 | + | 300 | WP_251873496.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NDK47_RS03160 (NDK47_03160) | 610414..610764 | + | 351 | WP_198828445.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NDK47_RS03165 (NDK47_03165) | 610923..611330 | + | 408 | WP_251873497.1 | anti-sigma regulatory factor | - |
NDK47_RS03170 (NDK47_03170) | 611355..612353 | + | 999 | WP_251873498.1 | SpoIIE family protein phosphatase | - |
NDK47_RS03175 (NDK47_03175) | 612376..612702 | + | 327 | WP_251873499.1 | STAS domain-containing protein | - |
NDK47_RS03180 (NDK47_03180) | 612702..613196 | + | 495 | WP_251873500.1 | anti-sigma B factor RsbW | - |
NDK47_RS03185 (NDK47_03185) | 613165..613953 | + | 789 | WP_251873501.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12961.98 Da Isoelectric Point: 4.8553
>T247995 WP_198828445.1 NZ_CP098755:610414-610764 [Brevibacillus sp. BB3-R1]
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKMYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMERVNESLQISLGIIDF
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKMYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMERVNESLQISLGIIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|