Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 939782..940233 Replicon chromosome
Accession NZ_CP098752
Organism Brachyspira pilosicoli strain MEI7141

Toxin (Protein)


Gene name hicA Uniprot ID J9UUS4
Locus tag NEI02_RS04090 Protein ID WP_014933300.1
Coordinates 939782..940015 (-) Length 78 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID D8IB43
Locus tag NEI02_RS04095 Protein ID WP_013243321.1
Coordinates 940012..940233 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NEI02_RS04080 (NEI02_04075) 935422..937839 + 2418 WP_013243318.1 PBP1A family penicillin-binding protein -
NEI02_RS04085 (NEI02_04080) 937845..939698 + 1854 WP_013243319.1 conjugal transfer protein TraB -
NEI02_RS04090 (NEI02_04085) 939782..940015 - 234 WP_014933300.1 type II toxin-antitoxin system HicA family toxin Toxin
NEI02_RS04095 (NEI02_04090) 940012..940233 - 222 WP_013243321.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NEI02_RS04100 (NEI02_04095) 940287..941720 - 1434 WP_284603203.1 hypothetical protein -
NEI02_RS04105 (NEI02_04100) 942006..942341 - 336 WP_232472976.1 Hsp20/alpha crystallin family protein -
NEI02_RS04110 (NEI02_04105) 942420..942821 - 402 WP_284603204.1 Hsp20/alpha crystallin family protein -
NEI02_RS04115 (NEI02_04110) 943132..943590 + 459 WP_013243324.1 large conductance mechanosensitive channel protein MscL -
NEI02_RS04120 (NEI02_04115) 943727..944872 + 1146 WP_013243325.1 alanine--glyoxylate aminotransferase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(10-64)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(6-70)


Sequences

Toxin        


Download         Length: 78 a.a.        Molecular weight: 9027.69 Da        Isoelectric Point: 10.1753

>T247992 WP_014933300.1 NZ_CP098752:c940015-939782 [Brachyspira pilosicoli]
MSKLILKDAKTIEKLLFLLGFVKQRQKGSHAFYKHEDGRCTVIPFHSSKVISRPLMRKILNEINLDVEEYNNLIEKI

Download         Length: 234 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8551.86 Da        Isoelectric Point: 4.3348

>AT247992 WP_013243321.1 NZ_CP098752:c940233-940012 [Brachyspira pilosicoli]
MKKKFFAYIEYDKETNVYVGYIPSIVGAHTQADTLEELHIKLKEVLDLCLEEMDSEEKKTIPEFVKVEEIELV

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J9UUS4

Antitoxin

Source ID Structure
AlphaFold DB A0A381A9L8

References