Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 969712..970163 Replicon chromosome
Accession NZ_CP098750
Organism Brachyspira pilosicoli strain ZH1243

Toxin (Protein)


Gene name hicA Uniprot ID J9UUS4
Locus tag NEI03_RS04345 Protein ID WP_014933300.1
Coordinates 969712..969945 (-) Length 78 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID D8IB43
Locus tag NEI03_RS04350 Protein ID WP_013243321.1
Coordinates 969942..970163 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NEI03_RS04335 (NEI03_04330) 965352..967769 + 2418 WP_013243318.1 PBP1A family penicillin-binding protein -
NEI03_RS04340 (NEI03_04335) 967775..969628 + 1854 WP_013243319.1 conjugal transfer protein TraB -
NEI03_RS04345 (NEI03_04340) 969712..969945 - 234 WP_014933300.1 type II toxin-antitoxin system HicA family toxin Toxin
NEI03_RS04350 (NEI03_04345) 969942..970163 - 222 WP_013243321.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NEI03_RS04355 (NEI03_04350) 970437..970772 - 336 WP_284622177.1 Hsp20/alpha crystallin family protein -
NEI03_RS04360 (NEI03_04355) 970863..971264 - 402 WP_157146546.1 Hsp20/alpha crystallin family protein -
NEI03_RS04365 (NEI03_04360) 971575..972033 + 459 WP_284622096.1 large conductance mechanosensitive channel protein MscL -
NEI03_RS04370 (NEI03_04365) 972169..973314 + 1146 WP_101503636.1 alanine--glyoxylate aminotransferase family protein -
NEI03_RS04375 (NEI03_04370) 973446..975050 + 1605 WP_013243326.1 phosphoglycerate dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(10-64)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(6-70)


Sequences

Toxin        


Download         Length: 78 a.a.        Molecular weight: 9027.69 Da        Isoelectric Point: 10.1753

>T247990 WP_014933300.1 NZ_CP098750:c969945-969712 [Brachyspira pilosicoli]
MSKLILKDAKTIEKLLFLLGFVKQRQKGSHAFYKHEDGRCTVIPFHSSKVISRPLMRKILNEINLDVEEYNNLIEKI

Download         Length: 234 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8551.86 Da        Isoelectric Point: 4.3348

>AT247990 WP_013243321.1 NZ_CP098750:c970163-969942 [Brachyspira pilosicoli]
MKKKFFAYIEYDKETNVYVGYIPSIVGAHTQADTLEELHIKLKEVLDLCLEEMDSEEKKTIPEFVKVEEIELV

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J9UUS4

Antitoxin

Source ID Structure
AlphaFold DB A0A381A9L8

References