Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 260266..260717 Replicon chromosome
Accession NZ_CP098749
Organism Brachyspira pilosicoli strain ZH1244

Toxin (Protein)


Gene name hicA Uniprot ID J9UUS4
Locus tag NEI00_RS01200 Protein ID WP_014933300.1
Coordinates 260484..260717 (+) Length 78 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID D8IB43
Locus tag NEI00_RS01195 Protein ID WP_013243321.1
Coordinates 260266..260487 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NEI00_RS01170 (NEI00_01170) 255379..256983 - 1605 WP_013243326.1 phosphoglycerate dehydrogenase -
NEI00_RS01175 (NEI00_01175) 257115..258260 - 1146 WP_284621214.1 alanine--glyoxylate aminotransferase family protein -
NEI00_RS01180 (NEI00_01180) 258396..258854 - 459 WP_284621215.1 large conductance mechanosensitive channel protein MscL -
NEI00_RS01185 (NEI00_01185) 259165..259566 + 402 WP_014933304.1 Hsp20/alpha crystallin family protein -
NEI00_RS01190 (NEI00_01190) 259657..259992 + 336 WP_232471225.1 Hsp20/alpha crystallin family protein -
NEI00_RS01195 (NEI00_01195) 260266..260487 + 222 WP_013243321.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NEI00_RS01200 (NEI00_01200) 260484..260717 + 234 WP_014933300.1 type II toxin-antitoxin system HicA family toxin Toxin
NEI00_RS01205 (NEI00_01205) 260801..262654 - 1854 WP_013243319.1 conjugal transfer protein TraB -
NEI00_RS01210 (NEI00_01210) 262661..265078 - 2418 WP_013243318.1 PBP1A family penicillin-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(10-64)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(6-70)


Sequences

Toxin        


Download         Length: 78 a.a.        Molecular weight: 9027.69 Da        Isoelectric Point: 10.1753

>T247989 WP_014933300.1 NZ_CP098749:260484-260717 [Brachyspira pilosicoli]
MSKLILKDAKTIEKLLFLLGFVKQRQKGSHAFYKHEDGRCTVIPFHSSKVISRPLMRKILNEINLDVEEYNNLIEKI

Download         Length: 234 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8551.86 Da        Isoelectric Point: 4.3348

>AT247989 WP_013243321.1 NZ_CP098749:260266-260487 [Brachyspira pilosicoli]
MKKKFFAYIEYDKETNVYVGYIPSIVGAHTQADTLEELHIKLKEVLDLCLEEMDSEEKKTIPEFVKVEEIELV

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J9UUS4

Antitoxin

Source ID Structure
AlphaFold DB A0A381A9L8

References