Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 939634..940085 Replicon chromosome
Accession NZ_CP098748
Organism Brachyspira pilosicoli strain ZH1268

Toxin (Protein)


Gene name hicA Uniprot ID J9UUS4
Locus tag NEI04_RS04105 Protein ID WP_014933300.1
Coordinates 939634..939867 (-) Length 78 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID D8IB43
Locus tag NEI04_RS04110 Protein ID WP_013243321.1
Coordinates 939864..940085 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NEI04_RS04095 (NEI04_04090) 935273..937690 + 2418 WP_013243318.1 PBP1A family penicillin-binding protein -
NEI04_RS04100 (NEI04_04095) 937697..939550 + 1854 WP_013243319.1 conjugal transfer protein TraB -
NEI04_RS04105 (NEI04_04100) 939634..939867 - 234 WP_014933300.1 type II toxin-antitoxin system HicA family toxin Toxin
NEI04_RS04110 (NEI04_04105) 939864..940085 - 222 WP_013243321.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NEI04_RS04115 (NEI04_04110) 940359..940694 - 336 WP_232471225.1 Hsp20/alpha crystallin family protein -
NEI04_RS04120 (NEI04_04115) 940785..941186 - 402 WP_157143032.1 Hsp20/alpha crystallin family protein -
NEI04_RS04125 (NEI04_04120) 941497..941955 + 459 WP_014936232.1 large conductance mechanosensitive channel protein MscL -
NEI04_RS04130 (NEI04_04125) 942090..943235 + 1146 WP_284601964.1 alanine--glyoxylate aminotransferase family protein -
NEI04_RS04135 (NEI04_04130) 943367..944971 + 1605 WP_013243326.1 phosphoglycerate dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(10-64)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(6-70)


Sequences

Toxin        


Download         Length: 78 a.a.        Molecular weight: 9027.69 Da        Isoelectric Point: 10.1753

>T247988 WP_014933300.1 NZ_CP098748:c939867-939634 [Brachyspira pilosicoli]
MSKLILKDAKTIEKLLFLLGFVKQRQKGSHAFYKHEDGRCTVIPFHSSKVISRPLMRKILNEINLDVEEYNNLIEKI

Download         Length: 234 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8551.86 Da        Isoelectric Point: 4.3348

>AT247988 WP_013243321.1 NZ_CP098748:c940085-939864 [Brachyspira pilosicoli]
MKKKFFAYIEYDKETNVYVGYIPSIVGAHTQADTLEELHIKLKEVLDLCLEEMDSEEKKTIPEFVKVEEIELV

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J9UUS4

Antitoxin

Source ID Structure
AlphaFold DB A0A381A9L8

References