Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 60695..61832 | Replicon | plasmid pEFM9-1 |
| Accession | NZ_CP098744 | ||
| Organism | Enterococcus faecalis strain M9 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | NDO76_RS13455 | Protein ID | WP_002332783.1 |
| Coordinates | 60695..61558 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | NDO76_RS13460 | Protein ID | WP_002326825.1 |
| Coordinates | 61560..61832 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDO76_RS13425 (NDO76_13425) | 56082..56876 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| NDO76_RS14085 | 57286..57369 | + | 84 | Protein_69 | MLS leader peptide | - |
| NDO76_RS13430 (NDO76_13430) | 57418..57501 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| NDO76_RS13435 (NDO76_13435) | 57626..58393 | + | 768 | WP_172688991.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| NDO76_RS13440 (NDO76_13440) | 58421..59101 | + | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
| NDO76_RS13445 (NDO76_13445) | 59135..59641 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| NDO76_RS13450 (NDO76_13450) | 59938..60255 | - | 318 | WP_002326830.1 | hypothetical protein | - |
| NDO76_RS13455 (NDO76_13455) | 60695..61558 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| NDO76_RS13460 (NDO76_13460) | 61560..61832 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| NDO76_RS13465 (NDO76_13465) | 61850..62065 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
| NDO76_RS13470 (NDO76_13470) | 62157..63053 | - | 897 | WP_002326827.1 | ParA family protein | - |
| NDO76_RS13475 (NDO76_13475) | 63156..63416 | - | 261 | Protein_79 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| NDO76_RS13480 (NDO76_13480) | 63586..64323 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| NDO76_RS13485 (NDO76_13485) | 64448..64531 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| NDO76_RS14090 | 64580..64663 | - | 84 | Protein_82 | MLS leader peptide | - |
| NDO76_RS13490 (NDO76_13490) | 64963..65334 | - | 372 | WP_002358205.1 | hypothetical protein | - |
| NDO76_RS13495 (NDO76_13495) | 65327..66172 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | cat / tet(L) / tet(M) / erm(A) / optrA / fexA / ant(6)-Ia / aph(3')-III / erm(B) / dfrG | - | 1..66643 | 66643 | |
| - | inside | IScluster/Tn | cat / tet(L) / tet(M) / erm(A) / optrA / fexA / ant(6)-Ia / aph(3')-III / erm(B) / dfrG | - | 24451..64323 | 39872 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T247981 WP_002332783.1 NZ_CP098744:c61558-60695 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |