Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 100351..100876 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP098742 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | NCG87_RS23975 | Protein ID | WP_001159868.1 |
| Coordinates | 100351..100656 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NCG87_RS23980 | Protein ID | WP_000813634.1 |
| Coordinates | 100658..100876 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCG87_RS23960 (96261) | 96261..97427 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| NCG87_RS23965 (98015) | 98015..98770 | - | 756 | WP_000852145.1 | replication initiation protein RepE | - |
| NCG87_RS23970 (99544) | 99544..100350 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| NCG87_RS23975 (100351) | 100351..100656 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NCG87_RS23980 (100658) | 100658..100876 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NCG87_RS23985 (101467) | 101467..101955 | + | 489 | WP_011254646.1 | hypothetical protein | - |
| NCG87_RS23990 (101989) | 101989..103122 | - | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
| NCG87_RS23995 (103289) | 103289..104062 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| NCG87_RS24000 (104075) | 104075..104575 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
| NCG87_RS24005 (104840) | 104840..105070 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| NCG87_RS24010 (105067) | 105067..105483 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / tet(B) | iutA / iucD / iucC / iucB / iucA | 1..109442 | 109442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T247968 WP_001159868.1 NZ_CP098742:c100656-100351 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|