Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 4696747..4697269 | Replicon | chromosome |
Accession | NZ_CP098741 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NCG87_RS22810 | Protein ID | WP_000221343.1 |
Coordinates | 4696747..4697031 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NCG87_RS22815 | Protein ID | WP_000885424.1 |
Coordinates | 4697021..4697269 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCG87_RS22790 (4692822) | 4692822..4694330 | - | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
NCG87_RS22795 (4694375) | 4694375..4694863 | + | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NCG87_RS22800 (4695056) | 4695056..4696135 | + | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NCG87_RS22805 (4696187) | 4696187..4696576 | - | 390 | WP_000194089.1 | RidA family protein | - |
NCG87_RS22810 (4696747) | 4696747..4697031 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NCG87_RS22815 (4697021) | 4697021..4697269 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NCG87_RS22820 (4697421) | 4697421..4697636 | + | 216 | WP_000206207.1 | hypothetical protein | - |
NCG87_RS22825 (4697626) | 4697626..4697958 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
NCG87_RS22830 (4698101) | 4698101..4699009 | + | 909 | WP_010989018.1 | hypothetical protein | - |
NCG87_RS22835 (4699065) | 4699065..4699779 | - | 715 | Protein_4446 | helix-turn-helix domain-containing protein | - |
NCG87_RS22840 (4700587) | 4700587..4702053 | - | 1467 | WP_000987828.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T247963 WP_000221343.1 NZ_CP098741:c4697031-4696747 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |