Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3641175..3641795 | Replicon | chromosome |
| Accession | NZ_CP098741 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NCG87_RS17505 | Protein ID | WP_001280991.1 |
| Coordinates | 3641175..3641393 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NCG87_RS17510 | Protein ID | WP_000344807.1 |
| Coordinates | 3641421..3641795 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCG87_RS17465 (3636399) | 3636399..3636968 | + | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
| NCG87_RS17470 (3637001) | 3637001..3637390 | - | 390 | WP_000961285.1 | MGMT family protein | - |
| NCG87_RS17480 (3637621) | 3637621..3639171 | - | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| NCG87_RS17485 (3639396) | 3639396..3639656 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NCG87_RS17490 (3639662) | 3639662..3639802 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NCG87_RS17495 (3639858) | 3639858..3640328 | - | 471 | WP_000136181.1 | YlaC family protein | - |
| NCG87_RS17500 (3640445) | 3640445..3640996 | - | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| NCG87_RS17505 (3641175) | 3641175..3641393 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NCG87_RS17510 (3641421) | 3641421..3641795 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NCG87_RS17515 (3642291) | 3642291..3645440 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NCG87_RS17520 (3645463) | 3645463..3646656 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T247962 WP_001280991.1 NZ_CP098741:c3641393-3641175 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT247962 WP_000344807.1 NZ_CP098741:c3641795-3641421 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|