Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1442212..1443128 | Replicon | chromosome |
Accession | NZ_CP098738 | ||
Organism | Bacillus halotolerans strain XE48 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NDR85_RS07305 | Protein ID | WP_044156223.1 |
Coordinates | 1442382..1443128 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A7G7U9Y3 |
Locus tag | NDR85_RS07300 | Protein ID | WP_024121090.1 |
Coordinates | 1442212..1442382 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDR85_RS07265 (NDR85_07255) | 1439076..1439405 | + | 330 | WP_044156231.1 | XkdW family protein | - |
NDR85_RS07270 (NDR85_07260) | 1439402..1439566 | + | 165 | WP_044156230.1 | XkdX family protein | - |
NDR85_RS07275 (NDR85_07265) | 1439610..1440449 | + | 840 | WP_044156229.1 | hypothetical protein | - |
NDR85_RS07280 (NDR85_07270) | 1440505..1440774 | + | 270 | WP_044156228.1 | hemolysin XhlA family protein | - |
NDR85_RS07285 (NDR85_07275) | 1440786..1441049 | + | 264 | WP_044156226.1 | phage holin | - |
NDR85_RS07290 (NDR85_07280) | 1441062..1441955 | + | 894 | WP_044156225.1 | N-acetylmuramoyl-L-alanine amidase | - |
NDR85_RS07295 (NDR85_07285) | 1441991..1442128 | - | 138 | WP_125825426.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NDR85_RS07300 (NDR85_07290) | 1442212..1442382 | - | 171 | WP_024121090.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NDR85_RS07305 (NDR85_07295) | 1442382..1443128 | - | 747 | WP_044156223.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NDR85_RS07310 (NDR85_07300) | 1443237..1444238 | - | 1002 | WP_044156221.1 | inorganic phosphate transporter | - |
NDR85_RS07315 (NDR85_07305) | 1444251..1444868 | - | 618 | WP_044156219.1 | DUF47 domain-containing protein | - |
NDR85_RS07320 (NDR85_07310) | 1445146..1446462 | - | 1317 | WP_044156218.1 | serine/threonine exchanger | - |
NDR85_RS07325 (NDR85_07315) | 1446857..1447807 | + | 951 | WP_044156217.1 | ring-cleaving dioxygenase | - |
NDR85_RS07330 (NDR85_07320) | 1447973..1448053 | + | 81 | Protein_1381 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29102.52 Da Isoelectric Point: 4.4373
>T247943 WP_044156223.1 NZ_CP098738:c1443128-1442382 [Bacillus halotolerans]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CYYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CYYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|