Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 522516..523152 | Replicon | chromosome |
Accession | NZ_CP098738 | ||
Organism | Bacillus halotolerans strain XE48 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NDR85_RS02665 | Protein ID | WP_003156187.1 |
Coordinates | 522802..523152 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NDR85_RS02660 | Protein ID | WP_003225183.1 |
Coordinates | 522516..522797 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDR85_RS02640 (NDR85_02640) | 518873..519472 | - | 600 | WP_263870885.1 | rhomboid family intramembrane serine protease | - |
NDR85_RS02645 (NDR85_02645) | 519567..519932 | + | 366 | WP_044161735.1 | holo-ACP synthase | - |
NDR85_RS02650 (NDR85_02650) | 520098..521114 | + | 1017 | WP_256766957.1 | outer membrane lipoprotein carrier protein LolA | - |
NDR85_RS02655 (NDR85_02655) | 521231..522400 | + | 1170 | WP_044161733.1 | alanine racemase | - |
NDR85_RS02660 (NDR85_02660) | 522516..522797 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NDR85_RS02665 (NDR85_02665) | 522802..523152 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NDR85_RS02670 (NDR85_02670) | 523268..524092 | + | 825 | WP_082687807.1 | RsbT co-antagonist protein RsbRA | - |
NDR85_RS02675 (NDR85_02675) | 524097..524462 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NDR85_RS02680 (NDR85_02680) | 524466..524867 | + | 402 | WP_024714447.1 | serine/threonine-protein kinase RsbT | - |
NDR85_RS02685 (NDR85_02685) | 524879..525886 | + | 1008 | WP_044161721.1 | phosphoserine phosphatase RsbU | - |
NDR85_RS02690 (NDR85_02690) | 525947..526276 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
NDR85_RS02695 (NDR85_02695) | 526273..526755 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
NDR85_RS02700 (NDR85_02700) | 526721..527509 | + | 789 | WP_044161720.1 | RNA polymerase sigma factor SigB | - |
NDR85_RS02705 (NDR85_02705) | 527509..528108 | + | 600 | WP_044161719.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T247942 WP_003156187.1 NZ_CP098738:522802-523152 [Bacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|