Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT_toxin-BrnA |
Location | 2743459..2743909 | Replicon | chromosome |
Accession | NZ_CP098736 | ||
Organism | Cupriavidus gilardii strain QJ1 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | NDR89_RS22575 | Protein ID | WP_232963065.1 |
Coordinates | 2743459..2743572 (+) | Length | 38 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | - |
Locus tag | NDR89_RS22580 | Protein ID | WP_252252901.1 |
Coordinates | 2743556..2743909 (+) | Length | 118 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDR89_RS22560 (NDR89_22560) | 2739632..2740339 | - | 708 | WP_252252899.1 | two-component system response regulator CreB | - |
NDR89_RS22565 (NDR89_22565) | 2740394..2741602 | - | 1209 | WP_252252900.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NDR89_RS22570 (NDR89_22570) | 2742077..2743258 | + | 1182 | WP_198751423.1 | benzoate/H(+) symporter BenE family transporter | - |
NDR89_RS22575 (NDR89_22575) | 2743459..2743572 | + | 114 | WP_232963065.1 | hypothetical protein | Toxin |
NDR89_RS22580 (NDR89_22580) | 2743556..2743909 | + | 354 | WP_252252901.1 | BrnA antitoxin family protein | Antitoxin |
NDR89_RS22585 (NDR89_22585) | 2743917..2744777 | + | 861 | WP_252252902.1 | aminoglycoside 6-adenylyltransferase | - |
NDR89_RS22590 (NDR89_22590) | 2744904..2745599 | - | 696 | WP_252252903.1 | TrkA family potassium uptake protein | - |
NDR89_RS22595 (NDR89_22595) | 2745592..2746920 | - | 1329 | WP_053821273.1 | potassium transporter TrkG | - |
NDR89_RS22600 (NDR89_22600) | 2747305..2747736 | + | 432 | WP_053821272.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 38 a.a. Molecular weight: 4405.10 Da Isoelectric Point: 9.2738
>T247941 WP_232963065.1 NZ_CP098736:2743459-2743572 [Cupriavidus gilardii]
IGTRLHCLIFTIRGDTLRAISLRKANFREVRDYEQEI
IGTRLHCLIFTIRGDTLRAISLRKANFREVRDYEQEI
Download Length: 114 bp
Antitoxin
Download Length: 118 a.a. Molecular weight: 12988.94 Da Isoelectric Point: 10.6742
>AT247941 WP_252252901.1 NZ_CP098736:2743556-2743909 [Cupriavidus gilardii]
MNRKSKLTMPAADENAAIARGIADDPDAVELTTEQIKRMRPAREALAEVLGERNVEALIKRRGRPALPAAERKVSQTLRL
DPDVLQAFKATGDGWQTRINDALRAYAKSHRMLPRGC
MNRKSKLTMPAADENAAIARGIADDPDAVELTTEQIKRMRPAREALAEVLGERNVEALIKRRGRPALPAAERKVSQTLRL
DPDVLQAFKATGDGWQTRINDALRAYAKSHRMLPRGC
Download Length: 354 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|