Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 178589..179193 | Replicon | chromosome |
| Accession | NZ_CP098735 | ||
| Organism | Cupriavidus gilardii strain QJ1 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | NDR89_RS00745 | Protein ID | WP_174780282.1 |
| Coordinates | 178888..179193 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | NDR89_RS00740 | Protein ID | WP_082371731.1 |
| Coordinates | 178589..178891 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDR89_RS00715 (NDR89_00715) | 173859..174836 | - | 978 | WP_053823860.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| NDR89_RS00720 (NDR89_00720) | 175066..175809 | + | 744 | WP_053823861.1 | GntR family transcriptional regulator | - |
| NDR89_RS00725 (NDR89_00725) | 175869..176240 | + | 372 | WP_053823862.1 | cupin domain-containing protein | - |
| NDR89_RS00730 (NDR89_00730) | 176362..177120 | + | 759 | WP_064575370.1 | glucose 1-dehydrogenase | - |
| NDR89_RS00735 (NDR89_00735) | 177229..178557 | + | 1329 | WP_006577627.1 | MFS transporter | - |
| NDR89_RS00740 (NDR89_00740) | 178589..178891 | - | 303 | WP_082371731.1 | putative addiction module antidote protein | Antitoxin |
| NDR89_RS00745 (NDR89_00745) | 178888..179193 | - | 306 | WP_174780282.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NDR89_RS00750 (NDR89_00750) | 179569..180621 | - | 1053 | WP_252251946.1 | MFS transporter | - |
| NDR89_RS00755 (NDR89_00755) | 180882..181277 | + | 396 | WP_053823866.1 | lysozyme inhibitor LprI family protein | - |
| NDR89_RS00760 (NDR89_00760) | 181293..183704 | - | 2412 | WP_252251947.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11285.06 Da Isoelectric Point: 10.7461
>T247938 WP_174780282.1 NZ_CP098735:c179193-178888 [Cupriavidus gilardii]
MIEIREYPPFRRWLSGLPDEATKAVIARRLMRLSVGNFGDAKSVGGGVSELRIDYGPGFRVYFAREGPRVVLLLGGGDKS
TQHLDIRKAQALWAEIKRTQA
MIEIREYPPFRRWLSGLPDEATKAVIARRLMRLSVGNFGDAKSVGGGVSELRIDYGPGFRVYFAREGPRVVLLLGGGDKS
TQHLDIRKAQALWAEIKRTQA
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|