Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1928671..1929305 Replicon chromosome
Accession NZ_CP098732
Organism Acinetobacter tibetensis strain Y-23

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M5E07_RS09440 Protein ID WP_252218742.1
Coordinates 1929126..1929305 (-) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag M5E07_RS09435 Protein ID WP_252218740.1
Coordinates 1928671..1929075 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5E07_RS09410 (M5E07_09410) 1924659..1926065 - 1407 WP_252218729.1 phage terminase large subunit -
M5E07_RS09415 (M5E07_09415) 1926055..1926525 - 471 WP_252218731.1 DUF2280 domain-containing protein -
M5E07_RS09420 (M5E07_09420) 1926572..1927213 - 642 WP_252218733.1 putative metallopeptidase -
M5E07_RS09425 (M5E07_09425) 1927173..1927649 - 477 WP_252218736.1 hypothetical protein -
M5E07_RS09430 (M5E07_09430) 1927729..1928493 - 765 WP_252218738.1 hypothetical protein -
M5E07_RS09435 (M5E07_09435) 1928671..1929075 - 405 WP_252218740.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M5E07_RS09440 (M5E07_09440) 1929126..1929305 - 180 WP_252218742.1 type II toxin-antitoxin system HicA family toxin Toxin
M5E07_RS09445 (M5E07_09445) 1929490..1929693 - 204 WP_252218744.1 acyl-CoA thioesterase -
M5E07_RS09450 (M5E07_09450) 1930297..1930587 - 291 WP_252218746.1 hypothetical protein -
M5E07_RS09460 (M5E07_09460) 1930989..1931225 - 237 WP_252218748.1 hypothetical protein -
M5E07_RS09465 (M5E07_09465) 1931653..1931904 - 252 WP_252218750.1 hypothetical protein -
M5E07_RS09470 (M5E07_09470) 1931917..1932357 - 441 WP_252218753.1 hypothetical protein -
M5E07_RS09475 (M5E07_09475) 1932367..1932780 - 414 WP_252218756.1 DUF1064 domain-containing protein -
M5E07_RS09480 (M5E07_09480) 1932777..1933730 - 954 WP_252218759.1 helix-turn-helix domain-containing protein -
M5E07_RS09485 (M5E07_09485) 1933727..1934035 - 309 WP_252218762.1 hypothetical protein -
M5E07_RS09490 (M5E07_09490) 1934032..1934295 - 264 WP_252218765.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1885330..1942683 57353


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6625.79 Da        Isoelectric Point: 10.7334

>T247937 WP_252218742.1 NZ_CP098732:c1929305-1929126 [Acinetobacter tibetensis]
MRSLDLIKKIEADGWYEVRVTGSHHHFKHPTKKGLVTIPHPKKDLPSGTVKSILKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14743.61 Da        Isoelectric Point: 4.2910

>AT247937 WP_252218740.1 NZ_CP098732:c1929075-1928671 [Acinetobacter tibetensis]
MLYPIAVERGSDSEAFGVIVPDIQGCFSAGDSFEEALENVKEAIAGHLEILAEDGEDIPLASEAANFFDDDEYKGMIWAL
VDVDVSRYLGKAEKINVTLPSRLIHLIDDRVKKDGRFKSRSAFLAASAERLLHT

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References