Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2721060..2721589 | Replicon | chromosome |
| Accession | NZ_CP098727 | ||
| Organism | Staphylococcus aureus strain SauR3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LC189_RS13270 | Protein ID | WP_000621175.1 |
| Coordinates | 2721227..2721589 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | LC189_RS13265 | Protein ID | WP_000948331.1 |
| Coordinates | 2721060..2721230 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LC189_RS13235 (LC189_013235) | 2716096..2716656 | + | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
| LC189_RS13240 (LC189_013240) | 2716865..2717344 | + | 480 | WP_001287079.1 | hypothetical protein | - |
| LC189_RS13245 (LC189_013245) | 2717337..2718920 | + | 1584 | WP_001294620.1 | PH domain-containing protein | - |
| LC189_RS13250 (LC189_013250) | 2718907..2719398 | + | 492 | WP_001205912.1 | PH domain-containing protein | - |
| LC189_RS13255 (LC189_013255) | 2719402..2719761 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| LC189_RS13260 (LC189_013260) | 2719827..2720975 | + | 1149 | WP_001281154.1 | alanine racemase | - |
| LC189_RS13265 (LC189_013265) | 2721060..2721230 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| LC189_RS13270 (LC189_013270) | 2721227..2721589 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LC189_RS13275 (LC189_013275) | 2721939..2722940 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| LC189_RS13280 (LC189_013280) | 2723059..2723385 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| LC189_RS13285 (LC189_013285) | 2723387..2723866 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| LC189_RS13290 (LC189_013290) | 2723841..2724611 | + | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T247933 WP_000621175.1 NZ_CP098727:2721227-2721589 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|