Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1155002..1155479 Replicon chromosome
Accession NZ_CP098727
Organism Staphylococcus aureus strain SauR3

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LC189_RS05690 Protein ID WP_000052076.1
Coordinates 1155291..1155479 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LC189_RS05685 Protein ID WP_001059690.1
Coordinates 1155002..1155262 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LC189_RS05655 (LC189_005655) 1150161..1150655 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
LC189_RS05660 (LC189_005660) 1150995..1152641 + 1647 WP_040968626.1 IS1182 family transposase -
LC189_RS05665 (LC189_005665) 1152729..1153346 + 618 WP_000255557.1 LysE/ArgO family amino acid transporter -
LC189_RS05670 (LC189_005670) 1153419..1154000 - 582 WP_001140695.1 histidine phosphatase family protein -
LC189_RS05675 (LC189_005675) 1154225..1154461 + 237 WP_000368687.1 hypothetical protein -
LC189_RS05680 (LC189_005680) 1154458..1154661 - 204 WP_000145164.1 sterile alpha motif-like domain-containing protein -
LC189_RS05685 (LC189_005685) 1155002..1155262 + 261 WP_001059690.1 hypothetical protein Antitoxin
LC189_RS05690 (LC189_005690) 1155291..1155479 + 189 WP_000052076.1 hypothetical protein Toxin
LC189_RS05695 (LC189_005695) 1155667..1156236 + 570 WP_001106652.1 lipoprotein N-acylation protein LnsA -
LC189_RS05700 (LC189_005700) 1156324..1156608 + 285 WP_001004399.1 hypothetical protein -
LC189_RS05705 (LC189_005705) 1156670..1156888 + 219 WP_000005886.1 hypothetical protein -
LC189_RS05710 (LC189_005710) 1157384..1157584 - 201 WP_001059082.1 cold-shock protein -
LC189_RS05715 (LC189_005715) 1157941..1158627 - 687 WP_001793574.1 thermonuclease family protein -
LC189_RS05720 (LC189_005720) 1158968..1159489 - 522 WP_000824487.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / sell / sec 1150161..1184360 34199
- flank IS/Tn - - 1150995..1152641 1646


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T247925 WP_000052076.1 NZ_CP098727:1155291-1155479 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT247925 WP_001059690.1 NZ_CP098727:1155002-1155262 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References