Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 120313..121089 | Replicon | chromosome |
| Accession | NZ_CP098727 | ||
| Organism | Staphylococcus aureus strain SauR3 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | LC189_RS00760 | Protein ID | WP_000031108.1 |
| Coordinates | 120937..121089 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | LC189_RS00755 | Protein ID | WP_001251228.1 |
| Coordinates | 120313..120912 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LC189_RS00735 (LC189_000735) | 116230..117687 | + | 1458 | WP_224558358.1 | ABC transporter permease subunit | - |
| LC189_RS00740 (LC189_000740) | 117680..118402 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| LC189_RS00745 (LC189_000745) | 118553..119680 | + | 1128 | WP_000379985.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| LC189_RS00750 (LC189_000750) | 119685..120155 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| LC189_RS00755 (LC189_000755) | 120313..120912 | + | 600 | WP_001251228.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| LC189_RS00760 (LC189_000760) | 120937..121089 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| LC189_RS00765 (LC189_000765) | 121981..122376 | + | 396 | WP_000901023.1 | hypothetical protein | - |
| LC189_RS00770 (LC189_000770) | 122572..123957 | + | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
| LC189_RS00775 (LC189_000775) | 124416..125237 | - | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T247923 WP_000031108.1 NZ_CP098727:120937-121089 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT247923 WP_001251228.1 NZ_CP098727:120313-120912 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEGLGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNIILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEGLGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNIILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|