Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3006425..3007094 | Replicon | chromosome |
| Accession | NZ_CP098724 | ||
| Organism | Yersinia ruckeri strain NVI-10571 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A380QS17 |
| Locus tag | ND438_RS13740 | Protein ID | WP_038241020.1 |
| Coordinates | 3006425..3006847 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | ND438_RS13745 | Protein ID | WP_004719196.1 |
| Coordinates | 3006828..3007094 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND438_RS13720 (ND438_13715) | 3002264..3003997 | - | 1734 | WP_038276198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| ND438_RS13725 (ND438_13720) | 3004004..3004720 | - | 717 | WP_004719192.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ND438_RS13730 (ND438_13725) | 3004752..3005651 | - | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
| ND438_RS13735 (ND438_13730) | 3005759..3006277 | + | 519 | WP_038241022.1 | flavodoxin FldB | - |
| ND438_RS13740 (ND438_13735) | 3006425..3006847 | - | 423 | WP_038241020.1 | protein YgfX | Toxin |
| ND438_RS13745 (ND438_13740) | 3006828..3007094 | - | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
| ND438_RS13750 (ND438_13745) | 3007388..3008380 | + | 993 | WP_096823598.1 | tRNA-modifying protein YgfZ | - |
| ND438_RS13755 (ND438_13750) | 3008519..3009184 | - | 666 | WP_175537887.1 | hemolysin III family protein | - |
| ND438_RS13760 (ND438_13755) | 3009501..3009757 | + | 257 | Protein_2669 | HD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16451.41 Da Isoelectric Point: 11.1478
>T247921 WP_038241020.1 NZ_CP098724:c3006847-3006425 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|