Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 2811691..2812424 Replicon chromosome
Accession NZ_CP098724
Organism Yersinia ruckeri strain NVI-10571

Toxin (Protein)


Gene name ypjF Uniprot ID -
Locus tag ND438_RS12870 Protein ID WP_096823575.1
Coordinates 2812095..2812424 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag ND438_RS12865 Protein ID WP_096823574.1
Coordinates 2811691..2812056 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND438_RS12820 (ND438_12815) 2806986..2807687 + 702 WP_050297207.1 WYL domain-containing protein -
ND438_RS12825 (ND438_12820) 2807693..2808259 + 567 WP_096823569.1 hypothetical protein -
ND438_RS12830 (ND438_12825) 2808298..2808750 + 453 WP_096823570.1 hypothetical protein -
ND438_RS12835 (ND438_12830) 2808747..2809185 + 439 Protein_2492 IrmA family protein -
ND438_RS12840 (ND438_12835) 2809258..2809524 + 267 Protein_2493 DUF905 family protein -
ND438_RS12845 (ND438_12840) 2809597..2810418 + 822 WP_096823571.1 DUF932 domain-containing protein -
ND438_RS12850 (ND438_12845) 2810449..2810892 + 444 WP_096823572.1 antirestriction protein -
ND438_RS12855 (ND438_12850) 2810905..2811447 + 543 WP_096823573.1 DNA repair protein RadC -
ND438_RS12860 (ND438_12855) 2811444..2811665 + 222 WP_069325310.1 DUF987 domain-containing protein -
ND438_RS12865 (ND438_12860) 2811691..2812056 + 366 WP_096823574.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ND438_RS12870 (ND438_12865) 2812095..2812424 + 330 WP_096823575.1 TA system toxin CbtA family protein Toxin
ND438_RS12875 (ND438_12870) 2812820..2813749 + 930 Protein_2500 integrase arm-type DNA-binding domain-containing protein -
ND438_RS12880 (ND438_12875) 2813995..2814549 + 555 WP_096823577.1 DUF4942 domain-containing protein -
ND438_RS12885 (ND438_12880) 2814658..2814981 + 324 WP_038277221.1 type II toxin-antitoxin system RelE/ParE family toxin -
ND438_RS12890 (ND438_12885) 2814968..2815249 + 282 WP_038277219.1 helix-turn-helix transcriptional regulator -
ND438_RS12895 (ND438_12890) 2815458..2816998 - 1541 Protein_2504 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2795348..2817999 22651
- flank IS/Tn - - 2817202..2817468 266


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12376.18 Da        Isoelectric Point: 8.0799

>T247920 WP_096823575.1 NZ_CP098724:2812095-2812424 [Yersinia ruckeri]
MQTLSSHPTRASQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFINETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK

Download         Length: 330 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13414.09 Da        Isoelectric Point: 5.4157

>AT247920 WP_096823574.1 NZ_CP098724:2811691-2812056 [Yersinia ruckeri]
MNNHSESVTKPENPACQQWGLKSTITPCFGARLVLEGNRLHFLADRAGFNGAFSDDDALHLDHAFPLILKQLELMLTSGE
LSPRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References