Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1877390..1878308 | Replicon | chromosome |
| Accession | NZ_CP098724 | ||
| Organism | Yersinia ruckeri strain NVI-10571 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | ND438_RS08385 | Protein ID | WP_038242633.1 |
| Coordinates | 1877850..1878308 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | ND438_RS08380 | Protein ID | WP_038242631.1 |
| Coordinates | 1877390..1877836 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND438_RS08360 (ND438_08355) | 1873088..1873792 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
| ND438_RS08365 (ND438_08360) | 1873803..1874777 | - | 975 | WP_071706618.1 | L-Ala-D/L-Glu epimerase | - |
| ND438_RS08370 (ND438_08365) | 1874927..1875430 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
| ND438_RS08375 (ND438_08370) | 1875465..1877072 | - | 1608 | WP_096823414.1 | transcriptional regulator TyrR | - |
| ND438_RS08380 (ND438_08375) | 1877390..1877836 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| ND438_RS08385 (ND438_08380) | 1877850..1878308 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
| ND438_RS08390 (ND438_08385) | 1878312..1879370 | - | 1059 | WP_038242635.1 | YcjF family protein | - |
| ND438_RS08395 (ND438_08390) | 1879367..1880764 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
| ND438_RS08400 (ND438_08395) | 1880745..1880987 | - | 243 | WP_096823415.1 | phage shock protein PspD | - |
| ND438_RS08405 (ND438_08400) | 1881051..1881410 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| ND438_RS08410 (ND438_08405) | 1881410..1881637 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
| ND438_RS08415 (ND438_08410) | 1881721..1882386 | - | 666 | WP_038275968.1 | phage shock protein PspA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T247915 WP_038242633.1 NZ_CP098724:1877850-1878308 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247915 WP_038242631.1 NZ_CP098724:1877390-1877836 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|