Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 954332..954955 | Replicon | chromosome |
Accession | NZ_CP098724 | ||
Organism | Yersinia ruckeri strain NVI-10571 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A085U5C4 |
Locus tag | ND438_RS04320 | Protein ID | WP_038243726.1 |
Coordinates | 954332..954535 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A085U5C5 |
Locus tag | ND438_RS04325 | Protein ID | WP_004718732.1 |
Coordinates | 954587..954955 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND438_RS04295 (ND438_04290) | 950187..950525 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
ND438_RS04300 (ND438_04295) | 950564..951853 | + | 1290 | WP_004718723.1 | ammonium transporter AmtB | - |
ND438_RS04305 (ND438_04300) | 951968..952831 | - | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
ND438_RS04310 (ND438_04305) | 953209..953523 | - | 315 | WP_004718728.1 | MGMT family protein | - |
ND438_RS04320 (ND438_04315) | 954332..954535 | - | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
ND438_RS04325 (ND438_04320) | 954587..954955 | - | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
ND438_RS04330 (ND438_04325) | 956028..956165 | + | 138 | WP_155274690.1 | hypothetical protein | - |
ND438_RS04335 (ND438_04330) | 956284..956427 | - | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
ND438_RS04340 (ND438_04335) | 956447..956701 | - | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T247914 WP_038243726.1 NZ_CP098724:c954535-954332 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT247914 WP_004718732.1 NZ_CP098724:c954955-954587 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C5 |