Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3142104..3142638 | Replicon | chromosome |
Accession | NZ_CP098723 | ||
Organism | Yersinia ruckeri strain NVI-11065 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0T9LYG3 |
Locus tag | ND444_RS14230 | Protein ID | WP_038275268.1 |
Coordinates | 3142104..3142394 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A1JJ37 |
Locus tag | ND444_RS14235 | Protein ID | WP_005175264.1 |
Coordinates | 3142384..3142638 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND444_RS14180 (ND444_14165) | 3137380..3137610 | - | 231 | Protein_2747 | DUF4942 domain-containing protein | - |
ND444_RS14185 (ND444_14170) | 3137760..3137888 | + | 129 | Protein_2748 | helix-turn-helix domain-containing protein | - |
ND444_RS14190 (ND444_14175) | 3137881..3138001 | + | 121 | Protein_2749 | transposase | - |
ND444_RS14195 (ND444_14180) | 3138030..3138326 | - | 297 | Protein_2750 | integrase core domain-containing protein | - |
ND444_RS14200 (ND444_14185) | 3138325..3138723 | + | 399 | Protein_2751 | integrase core domain-containing protein | - |
ND444_RS14205 (ND444_14190) | 3138742..3139008 | - | 267 | Protein_2752 | hypothetical protein | - |
ND444_RS14210 (ND444_14195) | 3139029..3140096 | - | 1068 | WP_096823272.1 | macro domain-containing protein | - |
ND444_RS14215 (ND444_14200) | 3140093..3140749 | - | 657 | WP_096823271.1 | DUF4433 domain-containing protein | - |
ND444_RS14220 (ND444_14205) | 3140752..3141327 | - | 576 | WP_265315943.1 | DUF4433 domain-containing protein | - |
ND444_RS14225 (ND444_14210) | 3141451..3141840 | - | 390 | WP_265315942.1 | restriction endonuclease subunit S | - |
ND444_RS14230 (ND444_14215) | 3142104..3142394 | - | 291 | WP_038275268.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ND444_RS14235 (ND444_14220) | 3142384..3142638 | - | 255 | WP_005175264.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ND444_RS14240 (ND444_14225) | 3142812..3143207 | - | 396 | Protein_2759 | tyrosine-type recombinase/integrase | - |
ND444_RS14245 (ND444_14230) | 3143232..3144382 | - | 1151 | Protein_2760 | IS3 family transposase | - |
ND444_RS14250 (ND444_14235) | 3144672..3146234 | + | 1563 | WP_265315941.1 | AAA family ATPase | - |
ND444_RS14255 (ND444_14240) | 3146219..3147241 | + | 1023 | WP_265315940.1 | TGBp1 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3138030..3173436 | 35406 | |
- | flank | IS/Tn | - | - | 3138030..3138278 | 248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11494.42 Da Isoelectric Point: 9.9816
>T247911 WP_038275268.1 NZ_CP098723:c3142394-3142104 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9LYG3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A1JJ37 |