Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2691806..2692429 | Replicon | chromosome |
| Accession | NZ_CP098723 | ||
| Organism | Yersinia ruckeri strain NVI-11065 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A085U5C4 |
| Locus tag | ND444_RS12275 | Protein ID | WP_038243726.1 |
| Coordinates | 2692226..2692429 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A085U5C5 |
| Locus tag | ND444_RS12270 | Protein ID | WP_004718732.1 |
| Coordinates | 2691806..2692174 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND444_RS12255 (ND444_12245) | 2690059..2690313 | + | 255 | WP_267260601.1 | type B 50S ribosomal protein L31 | - |
| ND444_RS12260 (ND444_12250) | 2690333..2690476 | + | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
| ND444_RS12265 (ND444_12255) | 2690595..2690732 | - | 138 | WP_186368427.1 | hypothetical protein | - |
| ND444_RS12270 (ND444_12260) | 2691806..2692174 | + | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
| ND444_RS12275 (ND444_12265) | 2692226..2692429 | + | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
| ND444_RS12285 (ND444_12275) | 2693238..2693552 | + | 315 | WP_004718728.1 | MGMT family protein | - |
| ND444_RS12290 (ND444_12280) | 2693930..2694793 | + | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
| ND444_RS12295 (ND444_12285) | 2694908..2696197 | - | 1290 | WP_265316202.1 | ammonium transporter AmtB | - |
| ND444_RS12300 (ND444_12290) | 2696236..2696574 | - | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T247908 WP_038243726.1 NZ_CP098723:2692226-2692429 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT247908 WP_004718732.1 NZ_CP098723:2691806-2692174 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085U5C4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085U5C5 |