Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1757304..1758222 | Replicon | chromosome |
| Accession | NZ_CP098723 | ||
| Organism | Yersinia ruckeri strain NVI-11065 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | ND444_RS08160 | Protein ID | WP_265316013.1 |
| Coordinates | 1757304..1757762 (-) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | ND444_RS08165 | Protein ID | WP_038242631.1 |
| Coordinates | 1757776..1758222 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND444_RS08130 (ND444_08125) | 1753226..1753891 | + | 666 | WP_145497062.1 | phage shock protein PspA | - |
| ND444_RS08135 (ND444_08130) | 1753975..1754202 | + | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
| ND444_RS08140 (ND444_08135) | 1754202..1754561 | + | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| ND444_RS08145 (ND444_08140) | 1754724..1754867 | + | 144 | WP_234049335.1 | phage shock protein PspD | - |
| ND444_RS08150 (ND444_08145) | 1754848..1756245 | + | 1398 | WP_004717556.1 | YcjX family protein | - |
| ND444_RS08155 (ND444_08150) | 1756242..1757300 | + | 1059 | WP_038242635.1 | YcjF family protein | - |
| ND444_RS08160 (ND444_08155) | 1757304..1757762 | - | 459 | WP_265316013.1 | RES domain-containing protein | Toxin |
| ND444_RS08165 (ND444_08160) | 1757776..1758222 | - | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| ND444_RS08170 (ND444_08165) | 1758540..1760147 | + | 1608 | WP_265316012.1 | transcriptional regulator TyrR | - |
| ND444_RS08175 (ND444_08170) | 1760182..1760685 | - | 504 | WP_004717547.1 | thiol peroxidase | - |
| ND444_RS08180 (ND444_08175) | 1760835..1761809 | + | 975 | WP_234056460.1 | L-Ala-D/L-Glu epimerase | - |
| ND444_RS08185 (ND444_08180) | 1761820..1762524 | - | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17040.51 Da Isoelectric Point: 6.6384
>T247907 WP_265316013.1 NZ_CP098723:c1757762-1757304 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPPPVATMDIGTEWIGSASSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPPPVATMDIGTEWIGSASSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247907 WP_038242631.1 NZ_CP098723:c1758222-1757776 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|