Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 701754..702423 | Replicon | chromosome |
| Accession | NZ_CP098723 | ||
| Organism | Yersinia ruckeri strain NVI-11065 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | ND444_RS03100 | Protein ID | WP_265315993.1 |
| Coordinates | 702001..702423 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | ND444_RS03095 | Protein ID | WP_004719196.1 |
| Coordinates | 701754..702020 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND444_RS03080 (ND444_03075) | 699091..699347 | - | 257 | Protein_594 | HD domain-containing protein | - |
| ND444_RS03085 (ND444_03080) | 699664..700329 | + | 666 | WP_175537887.1 | hemolysin III family protein | - |
| ND444_RS03090 (ND444_03085) | 700468..701460 | - | 993 | WP_038241018.1 | tRNA-modifying protein YgfZ | - |
| ND444_RS03095 (ND444_03090) | 701754..702020 | + | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
| ND444_RS03100 (ND444_03095) | 702001..702423 | + | 423 | WP_265315993.1 | protein YgfX | Toxin |
| ND444_RS03105 (ND444_03100) | 702571..703089 | - | 519 | WP_038241022.1 | flavodoxin FldB | - |
| ND444_RS03110 (ND444_03105) | 703197..704096 | + | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
| ND444_RS03115 (ND444_03110) | 704128..704844 | + | 717 | WP_004719192.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ND444_RS03120 (ND444_03115) | 704851..706584 | + | 1734 | WP_038276198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16511.51 Da Isoelectric Point: 11.1478
>T247902 WP_265315993.1 NZ_CP098723:702001-702423 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDFAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDFAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|