Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2820782..2821451 | Replicon | chromosome |
| Accession | NZ_CP098722 | ||
| Organism | Yersinia ruckeri strain NVI-11073 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A380QS17 |
| Locus tag | ND439_RS12720 | Protein ID | WP_038241020.1 |
| Coordinates | 2820782..2821204 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | ND439_RS12725 | Protein ID | WP_004719196.1 |
| Coordinates | 2821185..2821451 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND439_RS12700 (ND439_12690) | 2816621..2818354 | - | 1734 | WP_038276198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| ND439_RS12705 (ND439_12695) | 2818361..2819077 | - | 717 | WP_004719192.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ND439_RS12710 (ND439_12700) | 2819109..2820008 | - | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
| ND439_RS12715 (ND439_12705) | 2820116..2820634 | + | 519 | WP_038241022.1 | flavodoxin FldB | - |
| ND439_RS12720 (ND439_12710) | 2820782..2821204 | - | 423 | WP_038241020.1 | protein YgfX | Toxin |
| ND439_RS12725 (ND439_12715) | 2821185..2821451 | - | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
| ND439_RS12730 (ND439_12720) | 2821745..2822737 | + | 993 | WP_038241018.1 | tRNA-modifying protein YgfZ | - |
| ND439_RS12735 (ND439_12725) | 2822876..2823541 | - | 666 | WP_175537887.1 | hemolysin III family protein | - |
| ND439_RS12740 (ND439_12730) | 2823858..2824114 | + | 257 | Protein_2468 | HD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16451.41 Da Isoelectric Point: 11.1478
>T247901 WP_038241020.1 NZ_CP098722:c2821204-2820782 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|