Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 2073375..2074293 | Replicon | chromosome |
Accession | NZ_CP098719 | ||
Organism | Yersinia ruckeri strain NVI-11267 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | ND445_RS09425 | Protein ID | WP_038242633.1 |
Coordinates | 2073835..2074293 (+) | Length | 153 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A085U7R3 |
Locus tag | ND445_RS09420 | Protein ID | WP_038242631.1 |
Coordinates | 2073375..2073821 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND445_RS09400 (ND445_09395) | 2069073..2069777 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
ND445_RS09405 (ND445_09400) | 2069788..2070762 | - | 975 | WP_071706618.1 | L-Ala-D/L-Glu epimerase | - |
ND445_RS09410 (ND445_09405) | 2070912..2071415 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
ND445_RS09415 (ND445_09410) | 2071450..2073057 | - | 1608 | WP_096823414.1 | transcriptional regulator TyrR | - |
ND445_RS09420 (ND445_09415) | 2073375..2073821 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
ND445_RS09425 (ND445_09420) | 2073835..2074293 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
ND445_RS09430 (ND445_09425) | 2074297..2075355 | - | 1059 | WP_038242635.1 | YcjF family protein | - |
ND445_RS09435 (ND445_09430) | 2075352..2076749 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
ND445_RS09440 (ND445_09435) | 2076730..2076972 | - | 243 | WP_096823415.1 | phage shock protein PspD | - |
ND445_RS09445 (ND445_09440) | 2077036..2077395 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
ND445_RS09450 (ND445_09445) | 2077395..2077622 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
ND445_RS09455 (ND445_09450) | 2077706..2078371 | - | 666 | WP_038275968.1 | phage shock protein PspA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T247887 WP_038242633.1 NZ_CP098719:2073835-2074293 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247887 WP_038242631.1 NZ_CP098719:2073375-2073821 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|