Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 1921437..1922355 | Replicon | chromosome |
Accession | NZ_CP098716 | ||
Organism | Yersinia ruckeri strain NVI-11294 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | ND011_RS08745 | Protein ID | WP_038242633.1 |
Coordinates | 1921897..1922355 (+) | Length | 153 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A085U7R3 |
Locus tag | ND011_RS08740 | Protein ID | WP_038242631.1 |
Coordinates | 1921437..1921883 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND011_RS08720 (ND011_08710) | 1917135..1917839 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
ND011_RS08725 (ND011_08715) | 1917850..1918824 | - | 975 | WP_071706618.1 | L-Ala-D/L-Glu epimerase | - |
ND011_RS08730 (ND011_08720) | 1918974..1919477 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
ND011_RS08735 (ND011_08725) | 1919512..1921119 | - | 1608 | WP_096823414.1 | transcriptional regulator TyrR | - |
ND011_RS08740 (ND011_08730) | 1921437..1921883 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
ND011_RS08745 (ND011_08735) | 1921897..1922355 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
ND011_RS08750 (ND011_08740) | 1922359..1923417 | - | 1059 | WP_038242635.1 | YcjF family protein | - |
ND011_RS08755 (ND011_08745) | 1923414..1924811 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
ND011_RS08760 (ND011_08750) | 1924792..1925034 | - | 243 | WP_096823415.1 | phage shock protein PspD | - |
ND011_RS08765 (ND011_08755) | 1925098..1925457 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
ND011_RS08770 (ND011_08760) | 1925457..1925684 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
ND011_RS08775 (ND011_08765) | 1925768..1926433 | - | 666 | WP_038275968.1 | phage shock protein PspA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T247876 WP_038242633.1 NZ_CP098716:1921897-1922355 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247876 WP_038242631.1 NZ_CP098716:1921437-1921883 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|