Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 1877212..1878130 | Replicon | chromosome |
Accession | NZ_CP098714 | ||
Organism | Yersinia ruckeri strain NVI-1176 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | ND442_RS08390 | Protein ID | WP_038242633.1 |
Coordinates | 1877672..1878130 (+) | Length | 153 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A085U7R3 |
Locus tag | ND442_RS08385 | Protein ID | WP_038242631.1 |
Coordinates | 1877212..1877658 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND442_RS08365 (ND442_08360) | 1872910..1873614 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
ND442_RS08370 (ND442_08365) | 1873625..1874599 | - | 975 | WP_071706618.1 | L-Ala-D/L-Glu epimerase | - |
ND442_RS08375 (ND442_08370) | 1874749..1875252 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
ND442_RS08380 (ND442_08375) | 1875287..1876894 | - | 1608 | WP_096823414.1 | transcriptional regulator TyrR | - |
ND442_RS08385 (ND442_08380) | 1877212..1877658 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
ND442_RS08390 (ND442_08385) | 1877672..1878130 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
ND442_RS08395 (ND442_08390) | 1878134..1879192 | - | 1059 | WP_038242635.1 | YcjF family protein | - |
ND442_RS08400 (ND442_08395) | 1879189..1880586 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
ND442_RS08405 (ND442_08400) | 1880567..1880809 | - | 243 | WP_096823415.1 | phage shock protein PspD | - |
ND442_RS08410 (ND442_08405) | 1880873..1881232 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
ND442_RS08415 (ND442_08410) | 1881232..1881459 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
ND442_RS08420 (ND442_08415) | 1881543..1882208 | - | 666 | WP_038275968.1 | phage shock protein PspA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T247865 WP_038242633.1 NZ_CP098714:1877672-1878130 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247865 WP_038242631.1 NZ_CP098714:1877212-1877658 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|