Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3038668..3039348 | Replicon | chromosome |
Accession | NZ_CP098710 | ||
Organism | Yersinia ruckeri strain NVI-4479 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | ND012_RS13820 | Protein ID | WP_265320780.1 |
Coordinates | 3038668..3038988 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0T9UF43 |
Locus tag | ND012_RS13825 | Protein ID | WP_050082065.1 |
Coordinates | 3039025..3039348 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND012_RS13805 (ND012_13795) | 3035461..3037302 | + | 1842 | WP_004723328.1 | RNA polymerase sigma factor RpoD | - |
ND012_RS13815 (ND012_13805) | 3037722..3038555 | - | 834 | WP_265320781.1 | DUF4942 domain-containing protein | - |
ND012_RS13820 (ND012_13810) | 3038668..3038988 | - | 321 | WP_265320780.1 | toxin | Toxin |
ND012_RS13825 (ND012_13815) | 3039025..3039348 | - | 324 | WP_050082065.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
ND012_RS13830 (ND012_13820) | 3039361..3039831 | - | 471 | WP_234054729.1 | DNA repair protein RadC | - |
ND012_RS13835 (ND012_13825) | 3039902..3040591 | - | 690 | Protein_2683 | DUF932 domain-containing protein | - |
ND012_RS13840 (ND012_13830) | 3041173..3042873 | + | 1701 | WP_049600104.1 | group II intron reverse transcriptase/maturase | - |
ND012_RS13845 (ND012_13835) | 3042955..3043086 | - | 132 | Protein_2685 | DUF945 domain-containing protein | - |
ND012_RS13850 (ND012_13840) | 3043207..3043659 | - | 453 | WP_234054727.1 | IrmA family protein | - |
ND012_RS13855 (ND012_13845) | 3043656..3044108 | - | 453 | WP_234054726.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12042.65 Da Isoelectric Point: 6.6413
>T247850 WP_265320780.1 NZ_CP098710:c3038988-3038668 [Yersinia ruckeri]
MHISSVPATVPVASRLSPVQVWQQLLTYLLDHHYGLTLNDTPFHNDAAIQEHIEAGITLSDAVNFLVERYELVRSDRKGF
SWQEQTPFLTTTDILRARRATGLINK
MHISSVPATVPVASRLSPVQVWQQLLTYLLDHHYGLTLNDTPFHNDAAIQEHIEAGITLSDAVNFLVERYELVRSDRKGF
SWQEQTPFLTTTDILRARRATGLINK
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|