Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2889104..2889773 | Replicon | chromosome |
Accession | NZ_CP098710 | ||
Organism | Yersinia ruckeri strain NVI-4479 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A380QS17 |
Locus tag | ND012_RS13155 | Protein ID | WP_038241020.1 |
Coordinates | 2889104..2889526 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | ND012_RS13160 | Protein ID | WP_004719196.1 |
Coordinates | 2889507..2889773 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND012_RS13135 (ND012_13125) | 2884943..2886676 | - | 1734 | WP_038241024.1 | single-stranded-DNA-specific exonuclease RecJ | - |
ND012_RS13140 (ND012_13130) | 2886683..2887399 | - | 717 | WP_004719192.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
ND012_RS13145 (ND012_13135) | 2887431..2888330 | - | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
ND012_RS13150 (ND012_13140) | 2888438..2888956 | + | 519 | WP_038241022.1 | flavodoxin FldB | - |
ND012_RS13155 (ND012_13145) | 2889104..2889526 | - | 423 | WP_038241020.1 | protein YgfX | Toxin |
ND012_RS13160 (ND012_13150) | 2889507..2889773 | - | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
ND012_RS13165 (ND012_13155) | 2890067..2891059 | + | 993 | WP_038241018.1 | tRNA-modifying protein YgfZ | - |
ND012_RS13170 (ND012_13160) | 2891198..2891863 | - | 666 | WP_175537887.1 | hemolysin III family protein | - |
ND012_RS13175 (ND012_13165) | 2892180..2892436 | + | 257 | Protein_2554 | HD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16451.41 Da Isoelectric Point: 11.1478
>T247849 WP_038241020.1 NZ_CP098710:c2889526-2889104 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|