Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1828603..1829521 | Replicon | chromosome |
| Accession | NZ_CP098710 | ||
| Organism | Yersinia ruckeri strain NVI-4479 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | ND012_RS08145 | Protein ID | WP_038242633.1 |
| Coordinates | 1829063..1829521 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | ND012_RS08140 | Protein ID | WP_038242631.1 |
| Coordinates | 1828603..1829049 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND012_RS08120 (ND012_08110) | 1824301..1825005 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
| ND012_RS08125 (ND012_08115) | 1825016..1825990 | - | 975 | WP_071666721.1 | L-Ala-D/L-Glu epimerase | - |
| ND012_RS08130 (ND012_08120) | 1826140..1826643 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
| ND012_RS08135 (ND012_08125) | 1826678..1828285 | - | 1608 | WP_038251390.1 | transcriptional regulator TyrR | - |
| ND012_RS08140 (ND012_08130) | 1828603..1829049 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| ND012_RS08145 (ND012_08135) | 1829063..1829521 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
| ND012_RS08150 (ND012_08140) | 1829525..1830583 | - | 1059 | WP_248578616.1 | YcjF family protein | - |
| ND012_RS08155 (ND012_08145) | 1830580..1831977 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
| ND012_RS08160 (ND012_08150) | 1831958..1832200 | - | 243 | WP_087931058.1 | phage shock protein PspD | - |
| ND012_RS08165 (ND012_08155) | 1832264..1832623 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| ND012_RS08170 (ND012_08160) | 1832623..1832850 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
| ND012_RS08175 (ND012_08165) | 1832934..1833599 | - | 666 | WP_004717561.1 | phage shock protein PspA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T247844 WP_038242633.1 NZ_CP098710:1829063-1829521 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247844 WP_038242631.1 NZ_CP098710:1828603-1829049 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|