Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 914802..915425 | Replicon | chromosome |
Accession | NZ_CP098710 | ||
Organism | Yersinia ruckeri strain NVI-4479 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A085U5C4 |
Locus tag | ND012_RS04120 | Protein ID | WP_038243726.1 |
Coordinates | 914802..915005 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A085U5C5 |
Locus tag | ND012_RS04125 | Protein ID | WP_004718732.1 |
Coordinates | 915057..915425 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND012_RS04095 (ND012_04090) | 910657..910995 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
ND012_RS04100 (ND012_04095) | 911034..912323 | + | 1290 | WP_265320500.1 | ammonium transporter AmtB | - |
ND012_RS04105 (ND012_04100) | 912438..913301 | - | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
ND012_RS04110 (ND012_04105) | 913679..913993 | - | 315 | WP_248577445.1 | MGMT family protein | - |
ND012_RS04120 (ND012_04115) | 914802..915005 | - | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
ND012_RS04125 (ND012_04120) | 915057..915425 | - | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
ND012_RS04130 (ND012_04125) | 916474..916635 | + | 162 | WP_004718735.1 | hypothetical protein | - |
ND012_RS04135 (ND012_04130) | 916754..916897 | - | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
ND012_RS04140 (ND012_04135) | 916917..917171 | - | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T247843 WP_038243726.1 NZ_CP098710:c915005-914802 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT247843 WP_004718732.1 NZ_CP098710:c915425-915057 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C5 |