247840

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 471057..471591 Replicon chromosome
Accession NZ_CP098710
Organism Yersinia ruckeri strain NVI-4479

Toxin (Protein)


Gene name relE Uniprot ID A0A0T9LYG3
Locus tag ND012_RS02150 Protein ID WP_038275268.1
Coordinates 471301..471591 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A1JJ37
Locus tag ND012_RS02145 Protein ID WP_005175264.1
Coordinates 471057..471311 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND012_RS02125 (ND012_02125) 466107..466640 + 534 WP_267262542.1 hypothetical protein -
ND012_RS02130 (ND012_02130) 466674..467761 + 1088 WP_099511755.1 IS3 family transposase -
ND012_RS02135 (ND012_02135) 468166..469110 - 945 WP_248578899.1 hypothetical protein -
ND012_RS02140 (ND012_02140) 469624..470883 + 1260 Protein_414 integrase arm-type DNA-binding domain-containing protein -
ND012_RS02145 (ND012_02145) 471057..471311 + 255 WP_005175264.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
ND012_RS02150 (ND012_02150) 471301..471591 + 291 WP_038275268.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ND012_RS02155 (ND012_02155) 471855..472244 + 390 WP_234049240.1 restriction endonuclease subunit S -
ND012_RS02160 (ND012_02160) 472368..472943 + 576 WP_234049239.1 DarT ssDNA thymidine ADP-ribosyltransferase family protein -
ND012_RS02165 (ND012_02165) 472946..473602 + 657 WP_096823271.1 DUF4433 domain-containing protein -
ND012_RS02170 (ND012_02170) 473599..474666 + 1068 WP_096823272.1 macro domain-containing protein -
ND012_RS02175 (ND012_02175) 474687..474953 + 267 Protein_421 hypothetical protein -
ND012_RS02180 (ND012_02180) 474972..475370 - 399 Protein_422 integrase core domain-containing protein -
ND012_RS02185 (ND012_02185) 475369..475665 + 297 Protein_423 integrase core domain-containing protein -
ND012_RS02190 (ND012_02190) 475694..475814 - 121 Protein_424 transposase -
ND012_RS02195 (ND012_02195) 475807..475935 - 129 Protein_425 helix-turn-helix domain-containing protein -
ND012_RS02200 (ND012_02200) 476085..476315 + 231 Protein_426 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 457945..475665 17720
- flank IS/Tn - - 475417..475665 248


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11494.42 Da        Isoelectric Point: 9.9816

>T247840 WP_038275268.1 NZ_CP098710:471301-471591 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9680.07 Da        Isoelectric Point: 4.8283

>AT247840 WP_005175264.1 NZ_CP098710:471057-471311 [Yersinia ruckeri]
MSTIQIRVDDELKKSAYQAFEKLNLSPSDALRLFLRYVAENEKLPFSEVSVMVSNQDEDADILAVVRERLKNPAKRIRVN
IDDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0T9LYG3

Antitoxin

Source ID Structure
AlphaFold DB A1JJ37

References