Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3128792..3129326 | Replicon | chromosome |
| Accession | NZ_CP098703 | ||
| Organism | Yersinia ruckeri strain NVI-4840 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0T9LYG3 |
| Locus tag | ND437_RS14340 | Protein ID | WP_038275268.1 |
| Coordinates | 3128792..3129082 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A1JJ37 |
| Locus tag | ND437_RS14345 | Protein ID | WP_005175264.1 |
| Coordinates | 3129072..3129326 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND437_RS14290 (ND437_14280) | 3124068..3124298 | - | 231 | Protein_2777 | DUF4942 domain-containing protein | - |
| ND437_RS14295 (ND437_14285) | 3124448..3124576 | + | 129 | Protein_2778 | helix-turn-helix domain-containing protein | - |
| ND437_RS14300 (ND437_14290) | 3124569..3124689 | + | 121 | Protein_2779 | transposase | - |
| ND437_RS14305 (ND437_14295) | 3124718..3125014 | - | 297 | Protein_2780 | integrase core domain-containing protein | - |
| ND437_RS14310 (ND437_14300) | 3125013..3125411 | + | 399 | Protein_2781 | integrase core domain-containing protein | - |
| ND437_RS14315 (ND437_14305) | 3125430..3125696 | - | 267 | Protein_2782 | hypothetical protein | - |
| ND437_RS14320 (ND437_14310) | 3125717..3126784 | - | 1068 | WP_096823272.1 | macro domain-containing protein | - |
| ND437_RS14325 (ND437_14315) | 3126781..3127437 | - | 657 | WP_096823271.1 | DUF4433 domain-containing protein | - |
| ND437_RS14330 (ND437_14320) | 3127440..3128015 | - | 576 | WP_234049239.1 | DarT ssDNA thymidine ADP-ribosyltransferase family protein | - |
| ND437_RS14335 (ND437_14325) | 3128139..3128528 | - | 390 | WP_234049240.1 | restriction endonuclease subunit S | - |
| ND437_RS14340 (ND437_14330) | 3128792..3129082 | - | 291 | WP_038275268.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ND437_RS14345 (ND437_14335) | 3129072..3129326 | - | 255 | WP_005175264.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| ND437_RS14350 (ND437_14340) | 3129500..3129955 | - | 456 | Protein_2789 | site-specific integrase | - |
| ND437_RS14360 (ND437_14350) | 3131189..3132235 | - | 1047 | Protein_2791 | integrase arm-type DNA-binding domain-containing protein | - |
| ND437_RS14370 (ND437_14360) | 3132622..3133692 | - | 1071 | WP_038241732.1 | LPS export ABC transporter permease LptG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3124718..3132235 | 7517 | |
| - | flank | IS/Tn | - | - | 3124718..3124966 | 248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11494.42 Da Isoelectric Point: 9.9816
>T247827 WP_038275268.1 NZ_CP098703:c3129082-3128792 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0T9LYG3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A1JJ37 |