Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 3128792..3129326 Replicon chromosome
Accession NZ_CP098703
Organism Yersinia ruckeri strain NVI-4840

Toxin (Protein)


Gene name relE Uniprot ID A0A0T9LYG3
Locus tag ND437_RS14340 Protein ID WP_038275268.1
Coordinates 3128792..3129082 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A1JJ37
Locus tag ND437_RS14345 Protein ID WP_005175264.1
Coordinates 3129072..3129326 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND437_RS14290 (ND437_14280) 3124068..3124298 - 231 Protein_2777 DUF4942 domain-containing protein -
ND437_RS14295 (ND437_14285) 3124448..3124576 + 129 Protein_2778 helix-turn-helix domain-containing protein -
ND437_RS14300 (ND437_14290) 3124569..3124689 + 121 Protein_2779 transposase -
ND437_RS14305 (ND437_14295) 3124718..3125014 - 297 Protein_2780 integrase core domain-containing protein -
ND437_RS14310 (ND437_14300) 3125013..3125411 + 399 Protein_2781 integrase core domain-containing protein -
ND437_RS14315 (ND437_14305) 3125430..3125696 - 267 Protein_2782 hypothetical protein -
ND437_RS14320 (ND437_14310) 3125717..3126784 - 1068 WP_096823272.1 macro domain-containing protein -
ND437_RS14325 (ND437_14315) 3126781..3127437 - 657 WP_096823271.1 DUF4433 domain-containing protein -
ND437_RS14330 (ND437_14320) 3127440..3128015 - 576 WP_234049239.1 DarT ssDNA thymidine ADP-ribosyltransferase family protein -
ND437_RS14335 (ND437_14325) 3128139..3128528 - 390 WP_234049240.1 restriction endonuclease subunit S -
ND437_RS14340 (ND437_14330) 3128792..3129082 - 291 WP_038275268.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ND437_RS14345 (ND437_14335) 3129072..3129326 - 255 WP_005175264.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
ND437_RS14350 (ND437_14340) 3129500..3129955 - 456 Protein_2789 site-specific integrase -
ND437_RS14360 (ND437_14350) 3131189..3132235 - 1047 Protein_2791 integrase arm-type DNA-binding domain-containing protein -
ND437_RS14370 (ND437_14360) 3132622..3133692 - 1071 WP_038241732.1 LPS export ABC transporter permease LptG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3124718..3132235 7517
- flank IS/Tn - - 3124718..3124966 248


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11494.42 Da        Isoelectric Point: 9.9816

>T247827 WP_038275268.1 NZ_CP098703:c3129082-3128792 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9680.07 Da        Isoelectric Point: 4.8283

>AT247827 WP_005175264.1 NZ_CP098703:c3129326-3129072 [Yersinia ruckeri]
MSTIQIRVDDELKKSAYQAFEKLNLSPSDALRLFLRYVAENEKLPFSEVSVMVSNQDEDADILAVVRERLKNPAKRIRVN
IDDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0T9LYG3

Antitoxin

Source ID Structure
AlphaFold DB A1JJ37

References