Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2633022..2633645 | Replicon | chromosome |
Accession | NZ_CP098703 | ||
Organism | Yersinia ruckeri strain NVI-4840 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A085U5C4 |
Locus tag | ND437_RS12125 | Protein ID | WP_038243726.1 |
Coordinates | 2633442..2633645 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A085U5C5 |
Locus tag | ND437_RS12120 | Protein ID | WP_004718732.1 |
Coordinates | 2633022..2633390 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND437_RS12105 (ND437_12100) | 2631276..2631530 | + | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
ND437_RS12110 (ND437_12105) | 2631550..2631693 | + | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
ND437_RS12115 (ND437_12110) | 2631812..2631973 | - | 162 | WP_004718735.1 | hypothetical protein | - |
ND437_RS12120 (ND437_12115) | 2633022..2633390 | + | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
ND437_RS12125 (ND437_12120) | 2633442..2633645 | + | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
ND437_RS12135 (ND437_12130) | 2634454..2634768 | + | 315 | WP_248577445.1 | MGMT family protein | - |
ND437_RS12140 (ND437_12135) | 2635146..2636009 | + | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
ND437_RS12145 (ND437_12140) | 2636124..2637413 | - | 1290 | WP_004718723.1 | ammonium transporter AmtB | - |
ND437_RS12150 (ND437_12145) | 2637452..2637790 | - | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T247824 WP_038243726.1 NZ_CP098703:2633442-2633645 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT247824 WP_004718732.1 NZ_CP098703:2633022-2633390 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C5 |