Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 648223..648892 | Replicon | chromosome |
| Accession | NZ_CP098703 | ||
| Organism | Yersinia ruckeri strain NVI-4840 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A380QS17 |
| Locus tag | ND437_RS02825 | Protein ID | WP_038241020.1 |
| Coordinates | 648470..648892 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | ND437_RS02820 | Protein ID | WP_004719196.1 |
| Coordinates | 648223..648489 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND437_RS02805 (ND437_02800) | 645560..645816 | - | 257 | Protein_547 | HD domain-containing protein | - |
| ND437_RS02810 (ND437_02805) | 646133..646798 | + | 666 | WP_175537887.1 | hemolysin III family protein | - |
| ND437_RS02815 (ND437_02810) | 646937..647929 | - | 993 | WP_038241018.1 | tRNA-modifying protein YgfZ | - |
| ND437_RS02820 (ND437_02815) | 648223..648489 | + | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
| ND437_RS02825 (ND437_02820) | 648470..648892 | + | 423 | WP_038241020.1 | protein YgfX | Toxin |
| ND437_RS02830 (ND437_02825) | 649040..649558 | - | 519 | WP_038241022.1 | flavodoxin FldB | - |
| ND437_RS02835 (ND437_02830) | 649666..650565 | + | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
| ND437_RS02840 (ND437_02835) | 650597..651313 | + | 717 | WP_038276201.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ND437_RS02845 (ND437_02840) | 651320..653053 | + | 1734 | WP_267263262.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16451.41 Da Isoelectric Point: 11.1478
>T247818 WP_038241020.1 NZ_CP098703:648470-648892 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|