Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 3195548..3196082 Replicon chromosome
Accession NZ_CP098701
Organism Yersinia ruckeri strain NVI-5089

Toxin (Protein)


Gene name relE Uniprot ID A0A0T9LYG3
Locus tag ND440_RS14730 Protein ID WP_038275268.1
Coordinates 3195548..3195838 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A1JJ37
Locus tag ND440_RS14735 Protein ID WP_005175264.1
Coordinates 3195828..3196082 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND440_RS14680 (ND440_14675) 3190824..3191054 - 231 Protein_2844 DUF4942 domain-containing protein -
ND440_RS14685 (ND440_14680) 3191204..3191332 + 129 Protein_2845 helix-turn-helix domain-containing protein -
ND440_RS14690 (ND440_14685) 3191325..3191445 + 121 Protein_2846 transposase -
ND440_RS14695 (ND440_14690) 3191474..3191770 - 297 Protein_2847 integrase core domain-containing protein -
ND440_RS14700 (ND440_14695) 3191769..3192167 + 399 Protein_2848 integrase core domain-containing protein -
ND440_RS14705 (ND440_14700) 3192186..3192452 - 267 Protein_2849 hypothetical protein -
ND440_RS14710 (ND440_14705) 3192473..3193540 - 1068 WP_096823272.1 macro domain-containing protein -
ND440_RS14715 (ND440_14710) 3193537..3194193 - 657 WP_096823271.1 DUF4433 domain-containing protein -
ND440_RS14720 (ND440_14715) 3194196..3194771 - 576 WP_234049239.1 DarT ssDNA thymidine ADP-ribosyltransferase family protein -
ND440_RS14725 (ND440_14720) 3194895..3195284 - 390 WP_234049240.1 restriction endonuclease subunit S -
ND440_RS14730 (ND440_14725) 3195548..3195838 - 291 WP_038275268.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ND440_RS14735 (ND440_14730) 3195828..3196082 - 255 WP_005175264.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
ND440_RS14745 (ND440_14740) 3197428..3197673 + 246 Protein_2857 restriction endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3186962..3201094 14132
- inside IScluster/Tn - - 3191474..3197377 5903


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11494.42 Da        Isoelectric Point: 9.9816

>T247816 WP_038275268.1 NZ_CP098701:c3195838-3195548 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9680.07 Da        Isoelectric Point: 4.8283

>AT247816 WP_005175264.1 NZ_CP098701:c3196082-3195828 [Yersinia ruckeri]
MSTIQIRVDDELKKSAYQAFEKLNLSPSDALRLFLRYVAENEKLPFSEVSVMVSNQDEDADILAVVRERLKNPAKRIRVN
IDDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0T9LYG3

Antitoxin

Source ID Structure
AlphaFold DB A1JJ37

References